BLASTX nr result
ID: Glycyrrhiza24_contig00028563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028563 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588752.1| AFG1-family ATPase [Medicago truncatula] gi|... 105 3e-21 ref|NP_001242617.1| uncharacterized protein LOC100816565 [Glycin... 96 2e-18 ref|XP_002309615.1| predicted protein [Populus trichocarpa] gi|2... 87 2e-15 ref|XP_002282599.1| PREDICTED: lactation elevated protein 1 [Vit... 84 1e-14 ref|XP_004136476.1| PREDICTED: lactation elevated protein 1-like... 84 2e-14 >ref|XP_003588752.1| AFG1-family ATPase [Medicago truncatula] gi|355477800|gb|AES59003.1| AFG1-family ATPase [Medicago truncatula] Length = 830 Score = 105 bits (263), Expect = 3e-21 Identities = 54/66 (81%), Positives = 57/66 (86%), Gaps = 2/66 (3%) Frame = +3 Query: 3 SGGTPVGITSILSGQEEMFAFHRAVSRLIEMQTPLYLDGISNFHPYFQRQH--LQKNCDS 176 SGGTPVGITSILSGQEE+F F RAVSRLIEMQT LYLDG+SN HPYFQ QH QKN D+ Sbjct: 763 SGGTPVGITSILSGQEELFTFQRAVSRLIEMQTQLYLDGVSNVHPYFQTQHKKFQKNRDN 822 Query: 177 LLSESS 194 LLSESS Sbjct: 823 LLSESS 828 >ref|NP_001242617.1| uncharacterized protein LOC100816565 [Glycine max] gi|255634945|gb|ACU17831.1| unknown [Glycine max] Length = 504 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +3 Query: 3 SGGTPVGITSILSGQEEMFAFHRAVSRLIEMQTPLYLDGISNFHPYFQRQH 155 SGG P GITSIL GQEE+FAF RAVSRLIEMQTPLYLDG+SNFHPYFQRQH Sbjct: 448 SGGAPSGITSILFGQEEIFAFQRAVSRLIEMQTPLYLDGVSNFHPYFQRQH 498 >ref|XP_002309615.1| predicted protein [Populus trichocarpa] gi|222855591|gb|EEE93138.1| predicted protein [Populus trichocarpa] Length = 602 Score = 86.7 bits (213), Expect = 2e-15 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +3 Query: 3 SGGTPVGITSILSGQEEMFAFHRAVSRLIEMQTPLYLDGISNFHPYFQRQH 155 SGG P GI S+LSGQEEMFAF RA SRLIEMQTPLYL+G+ + HPYFQ+QH Sbjct: 535 SGGVPSGIVSMLSGQEEMFAFRRAASRLIEMQTPLYLEGVRSLHPYFQKQH 585 >ref|XP_002282599.1| PREDICTED: lactation elevated protein 1 [Vitis vinifera] gi|296082020|emb|CBI21025.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 84.0 bits (206), Expect = 1e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +3 Query: 3 SGGTPVGITSILSGQEEMFAFHRAVSRLIEMQTPLYLDGISNFHPYFQRQ 152 SGG P GI S+LSGQEEMFAF RAVSRLIEMQTPLYL+G+ + HPYFQ Q Sbjct: 538 SGGAPAGIISLLSGQEEMFAFRRAVSRLIEMQTPLYLEGVCDLHPYFQIQ 587 >ref|XP_004136476.1| PREDICTED: lactation elevated protein 1-like [Cucumis sativus] Length = 606 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = +3 Query: 3 SGGTPVGITSILSGQEEMFAFHRAVSRLIEMQTPLYLDGISNFHPYFQRQHLQKNCD 173 S G P I S+LSGQEEMFAF RAVSRLIEMQTPLYL+G+ N HPYFQR+ + + D Sbjct: 538 SVGAPTAIVSMLSGQEEMFAFRRAVSRLIEMQTPLYLEGVRNVHPYFQRREQESSVD 594