BLASTX nr result
ID: Glycyrrhiza24_contig00028539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028539 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containi... 54 1e-10 >ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Glycine max] Length = 342 Score = 54.3 bits (129), Expect(2) = 1e-10 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +3 Query: 177 MVIGSTMHYILILQSPLLLNHCP---STCPLQNLKQAVIAQAETKKHEKIPDVLISLESC 347 MV+ + MHY +L +LN CP S LQNL+QAV A+ E K + KIP++LIS ++C Sbjct: 1 MVMVAMMHYRFLLCFRPILNRCPLGRSVSSLQNLEQAVRAEVEAKNYIKIPELLISSDAC 60 Query: 348 QRSH 359 Q S+ Sbjct: 61 QISN 64 Score = 36.2 bits (82), Expect(2) = 1e-10 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = +1 Query: 391 NPRVQIIDAILQSLTPLRPHSKLWRVYS 474 N RVQI+D +LQSL P+RP SK YS Sbjct: 75 NIRVQIVDEMLQSLIPIRPRSKAQLTYS 102