BLASTX nr result
ID: Glycyrrhiza24_contig00028415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028415 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ30042.1| hypothetical protein mgI382 [Magnetospirillum gr... 109 2e-22 ref|ZP_05839395.1| conserved hypothetical protein [Brucella suis... 100 2e-19 emb|CBA31936.1| hypothetical protein Csp_D29610 [Curvibacter put... 89 3e-16 ref|ZP_08244250.1| Hypothetical Protein APO_2581 [Acetobacter po... 88 8e-16 ref|ZP_04645459.1| pG1 protein [Lactobacillus jensenii 269-3] gi... 80 2e-13 >emb|CAJ30042.1| hypothetical protein mgI382 [Magnetospirillum gryphiswaldense MSR-1] Length = 78 Score = 109 bits (273), Expect = 2e-22 Identities = 55/72 (76%), Positives = 58/72 (80%) Frame = +2 Query: 2 PTLSHLSVSTGPVSRLRHWCSSEYLRISPLHSEFHSPLLDSSDAVLKAVPELSSGLSPLT 181 PTLSH+SV+ P SRLRHWCSSEYLRISPLHSEFH PL DSS V KAVP LS GLS LT Sbjct: 3 PTLSHMSVNRRPGSRLRHWCSSEYLRISPLHSEFHYPLRDSSSTVSKAVPRLSPGLSLLT 62 Query: 182 YKAAYVRFTPSN 217 + A VRFTPSN Sbjct: 63 DRTACVRFTPSN 74 >ref|ZP_05839395.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261219753|ref|ZP_05934034.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261313973|ref|ZP_05953170.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261316150|ref|ZP_05955347.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|260154114|gb|EEW89197.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260924842|gb|EEX91410.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261295373|gb|EEX98869.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261302999|gb|EEY06496.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 62 Score = 100 bits (248), Expect = 2e-19 Identities = 50/60 (83%), Positives = 51/60 (85%) Frame = +2 Query: 2 PTLSHLSVSTGPVSRLRHWCSSEYLRISPLHSEFHSPLLDSSDAVLKAVPELSSGLSPLT 181 PTLSHLSVS GPVSRLRHWCSSEYLRISPLHSEFHSPL S V KAVP LS G+SPLT Sbjct: 3 PTLSHLSVSNGPVSRLRHWCSSEYLRISPLHSEFHSPLPYSRLPVSKAVPGLSPGISPLT 62 >emb|CBA31936.1| hypothetical protein Csp_D29610 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 76 Score = 89.4 bits (220), Expect = 3e-16 Identities = 48/72 (66%), Positives = 52/72 (72%) Frame = +2 Query: 2 PTLSHLSVSTGPVSRLRHWCSSEYLRISPLHSEFHSPLLDSSDAVLKAVPELSSGLSPLT 181 PTLS +SVSTGP LRH CSS YLRIS LH+EFH PL SSDAV A P LS G+S L+ Sbjct: 3 PTLSCMSVSTGPGDCLRHRCSSAYLRISLLHAEFHPPLPYSSDAVTNAGPRLSPGISHLS 62 Query: 182 YKAAYVRFTPSN 217 Y A RFTPSN Sbjct: 63 YITACARFTPSN 74 >ref|ZP_08244250.1| Hypothetical Protein APO_2581 [Acetobacter pomorum DM001] gi|326695169|gb|EGE46865.1| Hypothetical Protein APO_2581 [Acetobacter pomorum DM001] Length = 78 Score = 87.8 bits (216), Expect = 8e-16 Identities = 46/72 (63%), Positives = 51/72 (70%) Frame = +2 Query: 2 PTLSHLSVSTGPVSRLRHWCSSEYLRISPLHSEFHSPLLDSSDAVLKAVPELSSGLSPLT 181 PTLS LSVS P RLRH CSS+YLRISPLH EFH+PL SS V A P LS G+S LT Sbjct: 3 PTLSRLSVSNEPGCRLRHRCSSQYLRISPLHWEFHNPLSHSSLHVSNAAPRLSPGISHLT 62 Query: 182 YKAAYVRFTPSN 217 + AY FTPS+ Sbjct: 63 VQTAYTPFTPSH 74 >ref|ZP_04645459.1| pG1 protein [Lactobacillus jensenii 269-3] gi|238832245|gb|EEQ24559.1| pG1 protein [Lactobacillus jensenii 269-3] Length = 174 Score = 79.7 bits (195), Expect = 2e-13 Identities = 44/69 (63%), Positives = 47/69 (68%) Frame = +2 Query: 8 LSHLSVSTGPVSRLRHWCSSEYLRISPLHSEFHSPLLDSSDAVLKAVPELSSGLSPLTYK 187 LS LSVS P SRLRHWCSS YLRI PLH EF SPLL S V AV LS LS TY+ Sbjct: 2 LSSLSVSYRPESRLRHWCSSIYLRIPPLHMEFRSPLLHSRLTVSDAVLRLSRRLSHQTYQ 61 Query: 188 AAYVRFTPS 214 +A RFTP+ Sbjct: 62 SACARFTPN 70