BLASTX nr result
ID: Glycyrrhiza24_contig00028163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028163 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534406.1| PREDICTED: structural maintenance of chromos... 83 2e-14 ref|XP_003540578.1| PREDICTED: structural maintenance of chromos... 82 6e-14 ref|XP_003606501.1| Structural maintenance of chromosomes protei... 76 3e-12 ref|XP_002871281.1| structural maintenance of chromosomes family... 65 4e-09 ref|NP_196383.1| structural maintenance of chromosomes 6A [Arabi... 65 7e-09 >ref|XP_003534406.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Glycine max] Length = 1057 Score = 83.2 bits (204), Expect = 2e-14 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 119 TAGIIKRLRLENFMCHSNHETEFGNHVNFITGQNGSGKS 3 TAGI+KRLRLENFMCHS HETEFGNHVNFITGQNGSGKS Sbjct: 16 TAGIVKRLRLENFMCHSKHETEFGNHVNFITGQNGSGKS 54 >ref|XP_003540578.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Glycine max] Length = 193 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 119 TAGIIKRLRLENFMCHSNHETEFGNHVNFITGQNGSGKS 3 TAGI+K+LRLENFMCHS HETEFGNHVNFITGQNGSGKS Sbjct: 10 TAGIVKQLRLENFMCHSKHETEFGNHVNFITGQNGSGKS 48 >ref|XP_003606501.1| Structural maintenance of chromosomes protein [Medicago truncatula] gi|355507556|gb|AES88698.1| Structural maintenance of chromosomes protein [Medicago truncatula] Length = 622 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = -1 Query: 200 MKRGRDTWEGXXXXXXXXXXXXXXXPQTAGIIKRLRLENFMCHSNHETEFGNHVNFITGQ 21 MKR R T+E AGIIK+LRLENFMCHSNHET+FG++VN ITGQ Sbjct: 1 MKRARSTYESSSSRVSPSLE--------AGIIKKLRLENFMCHSNHETQFGSNVNLITGQ 52 Query: 20 NGSGKS 3 NGSGKS Sbjct: 53 NGSGKS 58 >ref|XP_002871281.1| structural maintenance of chromosomes family protein [Arabidopsis lyrata subsp. lyrata] gi|297317118|gb|EFH47540.1| structural maintenance of chromosomes family protein [Arabidopsis lyrata subsp. lyrata] Length = 1063 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 119 TAGIIKRLRLENFMCHSNHETEFGNHVNFITGQNGSGKS 3 ++G I R+RLENFMCHSN E EFG+ VNFITGQNGSGKS Sbjct: 18 SSGTIVRIRLENFMCHSNLEIEFGDWVNFITGQNGSGKS 56 >ref|NP_196383.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] gi|9759587|dbj|BAB11444.1| SMC-like protein [Arabidopsis thaliana] gi|332003807|gb|AED91190.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] Length = 1058 Score = 64.7 bits (156), Expect = 7e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 119 TAGIIKRLRLENFMCHSNHETEFGNHVNFITGQNGSGKS 3 ++G I R+RLENFMCHSN E EFG+ VNFITGQNGSGKS Sbjct: 19 SSGKILRIRLENFMCHSNLEIEFGDWVNFITGQNGSGKS 57