BLASTX nr result
ID: Glycyrrhiza24_contig00028133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00028133 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525674.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 gb|ACZ74655.1| hypothetical protein [Phaseolus vulgaris] gi|2703... 92 3e-17 ref|XP_003618141.1| Pentatricopeptide repeat-containing protein ... 89 3e-16 ref|XP_004156728.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|XP_004142850.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 >ref|XP_003525674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like [Glycine max] Length = 626 Score = 92.8 bits (229), Expect = 3e-17 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = +2 Query: 2 YNAVVKAFSEVGNVAELMELQDRLLKVGYVPNSLTCKHMIRRLQKDMELDDEILSHNMLE 181 YNAVVK F +VGNVAEL+ELQD+LLKVGYV N LTCK++I LQK ME DDE+L H+MLE Sbjct: 566 YNAVVKVFCDVGNVAELLELQDKLLKVGYVSNRLTCKYVIHGLQKAMEQDDEMLGHDMLE 625 Query: 182 V 184 V Sbjct: 626 V 626 >gb|ACZ74655.1| hypothetical protein [Phaseolus vulgaris] gi|270342076|gb|ACZ74661.1| hypothetical protein [Phaseolus vulgaris] Length = 485 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +2 Query: 2 YNAVVKAFSEVGNVAELMELQDRLLKVGYVPNSLTCKHMIRRLQKDMELDDEILSHNM 175 YNAVVK F +VGNV ELME++D+LLKVGYVPN LTC+H+I LQK MELDDEIL+H++ Sbjct: 427 YNAVVKVFCDVGNVTELMEVEDKLLKVGYVPNKLTCRHVIHGLQKAMELDDEILNHSL 484 >ref|XP_003618141.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355493156|gb|AES74359.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 846 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = +2 Query: 2 YNAVVKAFSEVGNVAELMELQDRLLKVGYVPNSLTCKHMIRRLQKDMELDDE 157 YNA+VK F EVGNVAELMELQD+L+K+GYVPNSLTCK++IR LQK MELDD+ Sbjct: 583 YNAIVKVFCEVGNVAELMELQDKLVKIGYVPNSLTCKYVIRGLQKGMELDDD 634 >ref|XP_004156728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like [Cucumis sativus] Length = 636 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +2 Query: 2 YNAVVKAFSEVGNVAELMELQDRLLKVGYVPNSLTCKHMIRRLQKDMELDDE 157 +N++VK + +VGN +LMELQDR+LK G++PNSLTC+++I + K M L+ + Sbjct: 578 FNSLVKVYRDVGNETKLMELQDRMLKAGFLPNSLTCRYIIHGIWKSMRLNKQ 629 >ref|XP_004142850.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like [Cucumis sativus] Length = 632 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +2 Query: 2 YNAVVKAFSEVGNVAELMELQDRLLKVGYVPNSLTCKHMIRRLQKDMELDDE 157 +N++VK + +VGN +LMELQDR+LK G++PNSLTC+++I + K M L+ + Sbjct: 574 FNSLVKVYRDVGNETKLMELQDRMLKAGFLPNSLTCRYIIHGIWKSMRLNKQ 625