BLASTX nr result
ID: Glycyrrhiza24_contig00027917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027917 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637522.1| Mutant low phytic acid protein [Medicago tru... 110 9e-23 ref|XP_003596767.1| hypothetical protein MTR_2g085410 [Medicago ... 110 9e-23 ref|XP_003638077.1| 2-phosphoglycerate kinase [Medicago truncatu... 105 4e-21 ref|XP_003538154.1| PREDICTED: uncharacterized protein DDB_G0273... 94 1e-17 ref|XP_002534208.1| conserved hypothetical protein [Ricinus comm... 93 3e-17 >ref|XP_003637522.1| Mutant low phytic acid protein [Medicago truncatula] gi|355503457|gb|AES84660.1| Mutant low phytic acid protein [Medicago truncatula] Length = 753 Score = 110 bits (276), Expect = 9e-23 Identities = 60/77 (77%), Positives = 65/77 (84%), Gaps = 2/77 (2%) Frame = -2 Query: 416 YRQNLDLFLRTRSEPVP--VASPEPICSYSSWLLEKSERKVSPSGKDKLRKRSLSIPALG 243 YRQNLD FLRTRSEPVP VAS EP C+Y S L EKSE+K+S +G+ KLRKRSLSIPALG Sbjct: 679 YRQNLDQFLRTRSEPVPIAVASQEPFCAYPSLLAEKSEKKLSSNGRAKLRKRSLSIPALG 738 Query: 242 KHSSAINDPILSGAPQR 192 KHSSA DPILSGAPQR Sbjct: 739 KHSSA--DPILSGAPQR 753 >ref|XP_003596767.1| hypothetical protein MTR_2g085410 [Medicago truncatula] gi|355485815|gb|AES67018.1| hypothetical protein MTR_2g085410 [Medicago truncatula] Length = 343 Score = 110 bits (276), Expect = 9e-23 Identities = 60/77 (77%), Positives = 65/77 (84%), Gaps = 2/77 (2%) Frame = -2 Query: 416 YRQNLDLFLRTRSEPVP--VASPEPICSYSSWLLEKSERKVSPSGKDKLRKRSLSIPALG 243 YRQNLD FLRTRSEPVP VAS EP C+Y S L EKSE+K+S +G+ KLRKRSLSIPALG Sbjct: 269 YRQNLDQFLRTRSEPVPIAVASQEPFCAYPSLLAEKSEKKLSSNGRAKLRKRSLSIPALG 328 Query: 242 KHSSAINDPILSGAPQR 192 KHSSA DPILSGAPQR Sbjct: 329 KHSSA--DPILSGAPQR 343 >ref|XP_003638077.1| 2-phosphoglycerate kinase [Medicago truncatula] gi|355504012|gb|AES85215.1| 2-phosphoglycerate kinase [Medicago truncatula] Length = 601 Score = 105 bits (262), Expect = 4e-21 Identities = 54/73 (73%), Positives = 61/73 (83%) Frame = -2 Query: 416 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKVSPSGKDKLRKRSLSIPALGKH 237 YRQNLDLFLRTRSEPVP E +CSYSS L+EK+ER++ PSGK KLRKRSLSI ALGK Sbjct: 533 YRQNLDLFLRTRSEPVP----ESLCSYSSLLMEKAERRLPPSGKAKLRKRSLSISALGKG 588 Query: 236 SSAINDPILSGAP 198 SS + DPI+SGAP Sbjct: 589 SSTVQDPIISGAP 601 >ref|XP_003538154.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like [Glycine max] Length = 704 Score = 94.0 bits (232), Expect = 1e-17 Identities = 51/75 (68%), Positives = 58/75 (77%) Frame = -2 Query: 416 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKVSPSGKDKLRKRSLSIPALGKH 237 YR+NLD+FLR+RSE EP+CSYSS L+EK+ERK KLR RSLSIPALGKH Sbjct: 641 YRRNLDIFLRSRSELA-----EPLCSYSSLLVEKNERK------SKLRTRSLSIPALGKH 689 Query: 236 SSAINDPILSGAPQR 192 SA+NDPILSGAPQR Sbjct: 690 RSAVNDPILSGAPQR 704 >ref|XP_002534208.1| conserved hypothetical protein [Ricinus communis] gi|223525703|gb|EEF28172.1| conserved hypothetical protein [Ricinus communis] Length = 716 Score = 92.8 bits (229), Expect = 3e-17 Identities = 47/75 (62%), Positives = 56/75 (74%) Frame = -2 Query: 416 YRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKVSPSGKDKLRKRSLSIPALGKH 237 Y QNLD FLRTRSEP+ EP+C+YSS L EK R++S SG K+R+RSLSIPA+GKH Sbjct: 646 YMQNLDRFLRTRSEPLA----EPLCAYSSLLAEKGGRRMSNSGSGKMRRRSLSIPAIGKH 701 Query: 236 SSAINDPILSGAPQR 192 S + PILSGAP R Sbjct: 702 GSEVAGPILSGAPHR 716