BLASTX nr result
ID: Glycyrrhiza24_contig00027699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027699 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612147.1| Filament-like plant protein [Medicago trunca... 122 4e-26 ref|XP_003516549.1| PREDICTED: filament-like plant protein 4-lik... 94 1e-17 emb|CBI17390.3| unnamed protein product [Vitis vinifera] 69 4e-10 ref|XP_002510512.1| Myosin heavy chain, striated muscle, putativ... 67 1e-09 ref|NP_195335.4| filament-like plant protein 5 [Arabidopsis thal... 66 3e-09 >ref|XP_003612147.1| Filament-like plant protein [Medicago truncatula] gi|355513482|gb|AES95105.1| Filament-like plant protein [Medicago truncatula] Length = 766 Score = 122 bits (305), Expect = 4e-26 Identities = 60/66 (90%), Positives = 62/66 (93%) Frame = +1 Query: 112 MDRRGWPWKKKPSDKITKAEKPVVTSDSVGSTLSSVAHLGDQQDNCTNKNYVQISMESYT 291 MDRRGWPWKKK SDKITKAEKP VT DSVGSTLSSVAHLG+ QDNCTNKNYVQISMESYT Sbjct: 1 MDRRGWPWKKKSSDKITKAEKPFVTLDSVGSTLSSVAHLGN-QDNCTNKNYVQISMESYT 59 Query: 292 RISGLE 309 R+SGLE Sbjct: 60 RMSGLE 65 >ref|XP_003516549.1| PREDICTED: filament-like plant protein 4-like [Glycine max] Length = 754 Score = 93.6 bits (231), Expect = 1e-17 Identities = 47/68 (69%), Positives = 53/68 (77%), Gaps = 2/68 (2%) Frame = +1 Query: 112 MDRRGWPWKKKPSDKITKAE--KPVVTSDSVGSTLSSVAHLGDQQDNCTNKNYVQISMES 285 MDRRGW WKK+ SDK K E KPV TS+ VG TL SVAH+GDQQD+ NKNYVQI+MES Sbjct: 1 MDRRGWLWKKRSSDKNIKVENEKPVSTSEFVGPTLFSVAHVGDQQDSSKNKNYVQITMES 60 Query: 286 YTRISGLE 309 Y +SGLE Sbjct: 61 YAHMSGLE 68 >emb|CBI17390.3| unnamed protein product [Vitis vinifera] Length = 994 Score = 68.9 bits (167), Expect = 4e-10 Identities = 39/68 (57%), Positives = 48/68 (70%) Frame = +1 Query: 106 SEMDRRGWPWKKKPSDKITKAEKPVVTSDSVGSTLSSVAHLGDQQDNCTNKNYVQISMES 285 SEMDR GWPWKKK SDK T EK TS S ++L+SVA L D ++N NYVQIS++S Sbjct: 15 SEMDR-GWPWKKKTSDK-TITEKTAATSGSDKASLASVASLSD-KENYNKVNYVQISLDS 71 Query: 286 YTRISGLE 309 YT ++G E Sbjct: 72 YTHMTGFE 79 >ref|XP_002510512.1| Myosin heavy chain, striated muscle, putative [Ricinus communis] gi|223551213|gb|EEF52699.1| Myosin heavy chain, striated muscle, putative [Ricinus communis] Length = 1041 Score = 67.0 bits (162), Expect = 1e-09 Identities = 36/66 (54%), Positives = 42/66 (63%) Frame = +1 Query: 112 MDRRGWPWKKKPSDKITKAEKPVVTSDSVGSTLSSVAHLGDQQDNCTNKNYVQISMESYT 291 MDRR WPWKKK SDK KA V T G +L+S D+ DN NYVQIS+ESYT Sbjct: 1 MDRRSWPWKKKSSDKTEKAA--VATDSGGGGSLASSGSQADK-DNYKKPNYVQISVESYT 57 Query: 292 RISGLE 309 ++GLE Sbjct: 58 HLTGLE 63 >ref|NP_195335.4| filament-like plant protein 5 [Arabidopsis thaliana] gi|205716586|sp|O65649.2|FPP5_ARATH RecName: Full=Filament-like plant protein 5; Short=AtFPP5 gi|332661222|gb|AEE86622.1| filament-like plant protein 5 [Arabidopsis thaliana] Length = 996 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/67 (53%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +1 Query: 112 MDRRGWPWKKKPSDKITKAEKPVVTSDSVG-STLSSVAHLGDQQDNCTNKNYVQISMESY 288 M+ RGWPWK+K SDK T EKPVV +S +LS +A L + Q+ C N NYVQI+M+SY Sbjct: 1 MEGRGWPWKRKSSDKAT-TEKPVVGIESTPVCSLSYLASL-ENQEKCKNTNYVQITMDSY 58 Query: 289 TRISGLE 309 T +S +E Sbjct: 59 THMSRME 65