BLASTX nr result
ID: Glycyrrhiza24_contig00027483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027483 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534675.1| PREDICTED: uncharacterized protein At5g23160... 57 2e-06 >ref|XP_003534675.1| PREDICTED: uncharacterized protein At5g23160-like [Glycine max] Length = 253 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 4/61 (6%) Frame = -2 Query: 172 TKTKTSIFLCCFGSSHLPNKASTESTM-KLGSDISIPKQKR---TSWFSWRRFRIKTKST 5 +K KTSIFLCCFGSSH + T+ + + S++ K+K+ TSWFSWRR R+ KS+ Sbjct: 8 SKPKTSIFLCCFGSSHAMESSPTKGSYDPIISEMKKKKKKKSTSTSWFSWRRIRLLKKSS 67 Query: 4 S 2 + Sbjct: 68 A 68