BLASTX nr result
ID: Glycyrrhiza24_contig00027473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027473 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603259.1| Ankyrin repeat domain-containing protein [Me... 98 8e-19 >ref|XP_003603259.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|355492307|gb|AES73510.1| Ankyrin repeat domain-containing protein [Medicago truncatula] Length = 427 Score = 97.8 bits (242), Expect = 8e-19 Identities = 43/66 (65%), Positives = 54/66 (81%) Frame = -3 Query: 300 FSGCYVFSMLVISPSIKFTISTVTLPCVLVALYSWGTSIYIRLAKRLRMYGREREDMSRF 121 F GCY+FSMLVI+PS F I TV +PC+LVA+Y WG IYI LA+++RMYGRE ED+S+F Sbjct: 362 FCGCYMFSMLVIAPSYTFGIVTVAIPCILVAVYFWGAMIYITLAQKVRMYGREWEDVSKF 421 Query: 120 SGGNRW 103 S GN+W Sbjct: 422 SEGNKW 427