BLASTX nr result
ID: Glycyrrhiza24_contig00027413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027413 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526241.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 gb|ABD28505.2| RNA-directed DNA polymerase (Reverse transcriptas... 55 5e-06 >ref|XP_002526241.1| conserved hypothetical protein [Ricinus communis] gi|223534435|gb|EEF36138.1| conserved hypothetical protein [Ricinus communis] Length = 299 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/72 (38%), Positives = 41/72 (56%) Frame = +2 Query: 35 LWAQVLRFKYGCGNLLLPSIKSGSHSSHLWKWICQQWPFVEKGLL*IVKGGHGIHFWQDS 214 LWAQ+L KY ++L S+ S S++WK IC WP V +GL + G+ FW D+ Sbjct: 105 LWAQILLSKYNNDHILDGSLTPKSGCSNIWKGICHTWPLVIQGLSWSIANGNTTRFWLDN 164 Query: 215 WVPEVGALIDHS 250 W+ + G L H+ Sbjct: 165 WLEDNGPLFVHA 176 >gb|ABD28505.2| RNA-directed DNA polymerase (Reverse transcriptase); Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 729 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/85 (35%), Positives = 42/85 (49%) Frame = +2 Query: 14 LISHKDALWAQVLRFKYGCGNLLLPSIKSGSHSSHLWKWICQQWPFVEKGLL*IVKGGHG 193 LI D LW +VL KYG N L +I S + S LWK I W ++ ++ + G Sbjct: 303 LIKQPDKLWCRVLYSKYGRNNDLNNNISSQPYDSPLWKAIVGIWDDFKRHVIWQIGDGRS 362 Query: 194 IHFWQDSWVPEVGALIDHSTLSILD 268 +FW D W+ +L ST S +D Sbjct: 363 TNFWLDKWISNNTSLFSSSTQSYVD 387