BLASTX nr result
ID: Glycyrrhiza24_contig00027355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027355 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539000.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 >ref|XP_003539000.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Glycine max] Length = 893 Score = 60.5 bits (145), Expect = 1e-07 Identities = 42/97 (43%), Positives = 54/97 (55%), Gaps = 4/97 (4%) Frame = +3 Query: 99 EKFNRKDGFEDDVAFKVDEEFVHKEGSSMR---NGKVRGKATKGFKKNGHDGKERSLDVK 269 +K + + +++ + DE V+KEG S R NGKVR ATKGF + DVK Sbjct: 118 QKHKKTENGDNNKIDREDEVGVYKEGCSTRSNNNGKVRRTATKGFTSENDGNLD---DVK 174 Query: 270 EKQRH-GANVRQDGRLKRQGHGLELESDDCSVIKSQG 377 KQ+ GANVRQ+G LKR+ LE ES D S I G Sbjct: 175 AKQKKSGANVRQNGPLKRRSRSLEPESYDGSEIGKSG 211