BLASTX nr result
ID: Glycyrrhiza24_contig00027292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027292 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090445.1| cytochrome c oxidase subunit 2, partial (mit... 108 5e-22 ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrio... 106 2e-21 gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa su... 106 2e-21 ref|YP_005090502.1| cytochrome c oxidase subunit 2 (mitochondrio... 106 2e-21 dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Ni... 104 7e-21 >ref|YP_005090445.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Millettia pinnata] gi|370288191|gb|AET62905.2| cytochrome c oxidase subunit 2, partial (mitochondrion) [Millettia pinnata] Length = 260 Score = 108 bits (270), Expect = 5e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = +2 Query: 2 LNQISILV*REGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQT 160 LNQISILV REGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQT Sbjct: 204 LNQISILVQREGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQT 256 >ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|2687657|gb|AAB88867.1| cytochrome c oxidase subunit II [Raphanus sativus] gi|400278265|dbj|BAM36189.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|400278309|dbj|BAM36232.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] Length = 260 Score = 106 bits (265), Expect = 2e-21 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 2 LNQISILV*REGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQT 160 LNQISILV REGVYYGQCSEICGTNHAFMPIVVEAVS KDYGSWVSNQLIPQT Sbjct: 205 LNQISILVQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa subsp. campestris] Length = 260 Score = 106 bits (265), Expect = 2e-21 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = +2 Query: 2 LNQISILV*REGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQT 160 LNQISILV REGVYYGQCSEICGTNHAFMPIVVEAVS KDYGSWVSNQLIPQT Sbjct: 205 LNQISILVQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >ref|YP_005090502.1| cytochrome c oxidase subunit 2 (mitochondrion) [Lotus japonicus] gi|357197366|gb|AET62962.1| cytochrome c oxidase subunit 2 (mitochondrion) [Lotus japonicus] Length = 257 Score = 106 bits (265), Expect = 2e-21 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +2 Query: 2 LNQISILV*REGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQ 157 LNQISILV REGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQ Sbjct: 204 LNQISILVQREGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQ 255 >dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Nicotiana tabacum] Length = 260 Score = 104 bits (260), Expect = 7e-21 Identities = 50/53 (94%), Positives = 50/53 (94%) Frame = +2 Query: 2 LNQISILV*REGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQT 160 LNQ SILV REGVYYGQCSEICGTNHAFMPIVVEAVS KDYGSWVSNQLIPQT Sbjct: 205 LNQTSILVQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257