BLASTX nr result
ID: Glycyrrhiza24_contig00027249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027249 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_04532941.1| conserved hypothetical protein [Escherichia s... 63 3e-08 ref|ZP_01951277.1| hypothetical protein A55_B0061 [Vibrio choler... 57 1e-06 ref|ZP_02997598.1| hypothetical protein PROSTU_01098 [Providenci... 55 5e-06 ref|ZP_03842742.1| conserved hypothetical protein [Proteus mirab... 55 6e-06 >ref|ZP_04532941.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|226903374|gb|EEH89633.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] Length = 66 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = -3 Query: 145 PLAETVLYPLQ*YMRRYLNSFRGEPAISELD*PFTPIHRSSANFSTVV 2 PL + P + RRYLNSFRGEPAIS D PFTP H+SSANFST+V Sbjct: 3 PLPKQCSTPGDEFTRRYLNSFRGEPAISRFDWPFTPSHKSSANFSTLV 50 >ref|ZP_01951277.1| hypothetical protein A55_B0061 [Vibrio cholerae 1587] gi|124113458|gb|EAY32278.1| hypothetical protein A55_B0061 [Vibrio cholerae 1587] Length = 41 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 TTVEKLADDLWIGVKG*SSSEIAGSPRKLFR 95 T VEKLADDLW+GVKG S+SEIAGSPRKLFR Sbjct: 11 TNVEKLADDLWLGVKGQSNSEIAGSPRKLFR 41 >ref|ZP_02997598.1| hypothetical protein PROSTU_01098 [Providencia stuartii ATCC 25827] gi|188022873|gb|EDU60913.1| hypothetical protein PROSTU_01098 [Providencia stuartii ATCC 25827] Length = 41 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 TTVEKLADDLWIGVKG*SSSEIAGSPRKLFR 95 T VEKLADDLW+GVKG S+ EIAGSPRKLFR Sbjct: 11 TNVEKLADDLWLGVKGQSNREIAGSPRKLFR 41 >ref|ZP_03842742.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906] gi|227161375|gb|EEI46427.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906] Length = 41 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 TTVEKLADDLWIGVKG*SSSEIAGSPRKLFR 95 T VEKLADDLW+GVKG S+ EIAGSPRKLFR Sbjct: 11 TNVEKLADDLWMGVKGQSNREIAGSPRKLFR 41