BLASTX nr result
ID: Glycyrrhiza24_contig00027102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027102 (540 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530367.1| PREDICTED: histone acetyltransferase HAC1-li... 94 1e-17 ref|XP_003529376.1| PREDICTED: histone acetyltransferase HAC1-li... 91 1e-16 ref|XP_003635871.1| Histone acetyltransferase [Medicago truncatu... 67 2e-09 ref|XP_003635872.1| Histone acetyltransferase [Medicago truncatu... 66 3e-09 ref|XP_002270538.2| PREDICTED: histone acetyltransferase HAC1-li... 64 1e-08 >ref|XP_003530367.1| PREDICTED: histone acetyltransferase HAC1-like [Glycine max] Length = 1698 Score = 94.0 bits (232), Expect = 1e-17 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 393 MKLQAHIPGQISGQVPNQAGSQLSGLTQLNGNALPSQMPPLGGVSRSTI 539 MKLQAHIPG++SGQVPNQAGSQLSGLTQLNGNALP QMPPLGGV RSTI Sbjct: 1 MKLQAHIPGEMSGQVPNQAGSQLSGLTQLNGNALPHQMPPLGGVPRSTI 49 >ref|XP_003529376.1| PREDICTED: histone acetyltransferase HAC1-like [Glycine max] Length = 1700 Score = 90.9 bits (224), Expect = 1e-16 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 393 MKLQAHIPGQISGQVPNQAGSQLSGLTQLNGNALPSQMPPLGGVSRSTI 539 MKLQAHIPG++SGQVPNQAGSQLSGLTQLNGNAL QMPPLGGV RSTI Sbjct: 1 MKLQAHIPGEMSGQVPNQAGSQLSGLTQLNGNALTHQMPPLGGVPRSTI 49 >ref|XP_003635871.1| Histone acetyltransferase [Medicago truncatula] gi|355501806|gb|AES83009.1| Histone acetyltransferase [Medicago truncatula] Length = 461 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +3 Query: 393 MKLQAHIPGQISGQVPNQAGSQLSGLTQLNGNALPSQMPPLGG 521 +KL+A I GQISG PNQAGSQL G TQLNGNALPS MP LGG Sbjct: 3 IKLEADISGQISGHAPNQAGSQLLGHTQLNGNALPSLMPSLGG 45 >ref|XP_003635872.1| Histone acetyltransferase [Medicago truncatula] gi|355501807|gb|AES83010.1| Histone acetyltransferase [Medicago truncatula] Length = 591 Score = 66.2 bits (160), Expect = 3e-09 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = +3 Query: 393 MKLQAHIPGQISGQVPNQAGSQLSGLTQLNGNALPSQMPPLGGVSRST 536 M QA IPG IS QVPNQAGSQL G TQLN NALP+QMP LGG + +T Sbjct: 1 MNQQADIPGHISRQVPNQAGSQLPGQTQLNVNALPAQMPSLGGSAINT 48 >ref|XP_002270538.2| PREDICTED: histone acetyltransferase HAC1-like isoform 1 [Vitis vinifera] Length = 1722 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 393 MKLQAHIPGQISGQVPNQAGSQLSGLTQLNGNALPSQMPPLGG 521 M +QAH+ GQ+SGQVPNQAGSQL GL Q NG++LPSQ+ LGG Sbjct: 1 MNIQAHMSGQMSGQVPNQAGSQLPGLPQQNGSSLPSQIQNLGG 43