BLASTX nr result
ID: Glycyrrhiza24_contig00027054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027054 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532627.1| PREDICTED: protein FAM135B-like [Glycine max] 61 1e-07 >ref|XP_003532627.1| PREDICTED: protein FAM135B-like [Glycine max] Length = 798 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = +1 Query: 322 MFRRLRWFVGLNQKNWSTKRLVNVE-QPGP 408 MFRRLRWFVGLNQKNWSTKRLVNV+ QPGP Sbjct: 1 MFRRLRWFVGLNQKNWSTKRLVNVDHQPGP 30