BLASTX nr result
ID: Glycyrrhiza24_contig00027047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027047 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630219.1| Protein kinase [Medicago truncatula] gi|3555... 74 9e-12 ref|XP_003630227.1| Protein kinase [Medicago truncatula] gi|3555... 62 5e-08 ref|XP_003602560.1| Protein kinase [Medicago truncatula] gi|3554... 57 2e-06 >ref|XP_003630219.1| Protein kinase [Medicago truncatula] gi|355524241|gb|AET04695.1| Protein kinase [Medicago truncatula] Length = 676 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/44 (79%), Positives = 43/44 (97%) Frame = -3 Query: 292 PEDELRIELEMIEQKYQEAIKDLSKRKSLAIMEIKRRMSEKMVS 161 P+DELR+ELEMIEQKY+EAI+DLSKR++LAI EIK+RMS+KMVS Sbjct: 633 PDDELRVELEMIEQKYEEAIRDLSKRRNLAIEEIKKRMSDKMVS 676 >ref|XP_003630227.1| Protein kinase [Medicago truncatula] gi|355524249|gb|AET04703.1| Protein kinase [Medicago truncatula] Length = 667 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/37 (75%), Positives = 36/37 (97%) Frame = -3 Query: 292 PEDELRIELEMIEQKYQEAIKDLSKRKSLAIMEIKRR 182 P+DELR+ELEMIEQKY+EAI+DLSKR++LAI EIK++ Sbjct: 628 PDDELRVELEMIEQKYEEAIRDLSKRRNLAIEEIKKK 664 >ref|XP_003602560.1| Protein kinase [Medicago truncatula] gi|355491608|gb|AES72811.1| Protein kinase [Medicago truncatula] Length = 675 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -3 Query: 295 EPEDELRIELEMIEQKYQEAIKDLSKRKSLAIMEIKRRMSEK 170 E EDELRIELE IE++YQEA+KDL KR+ A+ME ++R+S+K Sbjct: 629 EAEDELRIELEKIERQYQEAMKDLCKRRHDAMMETRKRLSQK 670