BLASTX nr result
ID: Glycyrrhiza24_contig00027028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00027028 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528294.1| PREDICTED: heat stress transcription factor ... 108 3e-22 emb|CBI19505.3| unnamed protein product [Vitis vinifera] 108 6e-22 gb|ABK95877.1| unknown [Populus trichocarpa] 108 6e-22 ref|XP_002284836.1| PREDICTED: heat stress transcription factor ... 108 6e-22 ref|XP_003523945.1| PREDICTED: heat stress transcription factor ... 108 6e-22 >ref|XP_003528294.1| PREDICTED: heat stress transcription factor B-4-like [Glycine max] gi|83853831|gb|ABC47863.1| Heat shock transcription factor (HSF) [Glycine max] Length = 363 Score = 108 bits (271), Expect = 3e-22 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +2 Query: 83 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 238 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >emb|CBI19505.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 108 bits (269), Expect = 6e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 83 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 238 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >gb|ABK95877.1| unknown [Populus trichocarpa] Length = 368 Score = 108 bits (269), Expect = 6e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 83 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 238 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >ref|XP_002284836.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera] gi|147768919|emb|CAN66983.1| hypothetical protein VITISV_004457 [Vitis vinifera] Length = 363 Score = 108 bits (269), Expect = 6e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 83 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 238 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >ref|XP_003523945.1| PREDICTED: heat stress transcription factor B-4-like [Glycine max] gi|83853818|gb|ABC47851.1| heat shock transcription factor [Glycine max] Length = 363 Score = 108 bits (269), Expect = 6e-22 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +2 Query: 83 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 238 MA+LLDNCEGILLSLDSHKSVPAPFLTKTYQLVD+PTTDHIVSWGEDDTTFV Sbjct: 1 MAVLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDEPTTDHIVSWGEDDTTFV 52