BLASTX nr result
ID: Glycyrrhiza24_contig00026854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00026854 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containi... 126 2e-27 ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containi... 123 2e-26 ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containi... 123 2e-26 ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 emb|CBI40653.3| unnamed protein product [Vitis vinifera] 120 1e-25 >ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 818 Score = 126 bits (317), Expect = 2e-27 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -1 Query: 384 LNTSPGTTIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 211 LNTSPGTT+HIRKNLRVCGDCH+ TKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW Sbjct: 761 LNTSPGTTLHIRKNLRVCGDCHDTTKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 818 >ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 123 bits (308), Expect = 2e-26 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -1 Query: 384 LNTSPGTTIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 211 LNTSPGTTIH+RKNLRVCGDCH ATKYISLVTGREIIVRD++RFHHFKNG CSCGDYW Sbjct: 764 LNTSPGTTIHVRKNLRVCGDCHNATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 123 bits (308), Expect = 2e-26 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -1 Query: 384 LNTSPGTTIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 211 LNTSPGTTIH+RKNLRVCGDCH ATKYISLVTGREIIVRD++RFHHFKNG CSCGDYW Sbjct: 764 LNTSPGTTIHVRKNLRVCGDCHNATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 816 Score = 120 bits (301), Expect = 1e-25 Identities = 54/58 (93%), Positives = 54/58 (93%) Frame = -1 Query: 384 LNTSPGTTIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 211 LNT GT IHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNG CSCGDYW Sbjct: 759 LNTRHGTAIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGICSCGDYW 816 >emb|CBI40653.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 120 bits (301), Expect = 1e-25 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -1 Query: 384 LNTSPGTTIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 211 LNTSPGTTIH+RKNLRVCGDCH ATKYISLVT REIIVRD+RRFHHFK+G+CSCGDYW Sbjct: 540 LNTSPGTTIHLRKNLRVCGDCHNATKYISLVTKREIIVRDMRRFHHFKDGTCSCGDYW 597