BLASTX nr result
ID: Glycyrrhiza24_contig00026798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00026798 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542569.1| PREDICTED: bifunctional monodehydroascorbate... 70 1e-10 ref|XP_003535188.1| PREDICTED: bifunctional monodehydroascorbate... 69 5e-10 ref|XP_004168624.1| PREDICTED: bifunctional monodehydroascorbate... 68 7e-10 ref|XP_004137981.1| PREDICTED: bifunctional monodehydroascorbate... 68 7e-10 ref|XP_004143278.1| PREDICTED: bifunctional monodehydroascorbate... 67 1e-09 >ref|XP_003542569.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Glycine max] Length = 282 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 342 LWNIDKKIRTVSRAQVKLLRHAVHDHAEMNARPRQPHNNREIHLH 208 +W I+KKIRTVSRAQVKLLR AVHDHAE NARP QP N R I L+ Sbjct: 232 IWTINKKIRTVSRAQVKLLREAVHDHAEKNARPIQPINRRGIQLY 276 >ref|XP_003535188.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Glycine max] Length = 278 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -1 Query: 342 LWNIDKKIRTVSRAQVKLLRHAVHDHAEMNARPRQPHNNREIHLH 208 +W I+KKIRTVSRAQV LLR AVHDHAE NARP QP N R I L+ Sbjct: 228 IWTINKKIRTVSRAQVNLLREAVHDHAEKNARPIQPLNRRGIQLY 272 >ref|XP_004168624.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Cucumis sativus] Length = 280 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 342 LWNIDKKIRTVSRAQVKLLRHAVHDHAEMNARPRQPHNNREIHLH 208 +WNI KKI TVSR QVKLLR AVHD AE NARP QPHN R I L+ Sbjct: 227 IWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHIDLY 271 >ref|XP_004137981.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Cucumis sativus] Length = 352 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 342 LWNIDKKIRTVSRAQVKLLRHAVHDHAEMNARPRQPHNNREIHLH 208 +WNI KKI TVSR QVKLLR AVHD AE NARP QPHN R I L+ Sbjct: 299 IWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHIDLY 343 >ref|XP_004143278.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Cucumis sativus] Length = 276 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 342 LWNIDKKIRTVSRAQVKLLRHAVHDHAEMNARPRQPHNNREIHLHQ 205 +W ++KKIRTVSR QV+LLR AVHD+AE NARP QP N+REI L++ Sbjct: 224 IWTMNKKIRTVSREQVRLLREAVHDYAEFNARPLQPLNSREIGLYR 269