BLASTX nr result
ID: Glycyrrhiza24_contig00026631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00026631 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597699.1| Ethylene-responsive transcription factor TIN... 63 3e-08 ref|XP_003542090.1| PREDICTED: dehydration-responsive element-bi... 55 8e-06 >ref|XP_003597699.1| Ethylene-responsive transcription factor TINY [Medicago truncatula] gi|355486747|gb|AES67950.1| Ethylene-responsive transcription factor TINY [Medicago truncatula] Length = 206 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 167 KPQETETGKQSRAKRSRGCSKHPVYHGVRMRSWGKRV 277 KP++TET KQS+ K++R C+ HPVYHGVRMRSWGK V Sbjct: 17 KPKKTETKKQSKVKKNRDCNSHPVYHGVRMRSWGKWV 53 >ref|XP_003542090.1| PREDICTED: dehydration-responsive element-binding protein 3-like [Glycine max] Length = 211 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 167 KPQETETGKQSRAKRSRGCSKHPVYHGVRMRSWGKRV 277 KP +TET KQS+AKR+R +KH YHGVRMR+WGK V Sbjct: 22 KPLKTETPKQSKAKRNRDPTKHSDYHGVRMRNWGKWV 58