BLASTX nr result
ID: Glycyrrhiza24_contig00026594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00026594 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 84 1e-14 tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea m... 67 1e-09 ref|XP_003609382.1| Structural maintenance of chromosomes protei... 67 2e-09 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 66 3e-09 ref|XP_002517741.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/49 (81%), Positives = 42/49 (85%) Frame = -3 Query: 401 GRGGSTRSVEFRRKTVGSRWRHFFGPLQKKGNAGRVKLGRGFENRVGSC 255 G GGSTRSV+FRRKTVGSRWR FFGPLQK+ VKLGRGFENRVGSC Sbjct: 37 GGGGSTRSVKFRRKTVGSRWRPFFGPLQKEMRGRGVKLGRGFENRVGSC 85 >tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea mays] Length = 88 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 399 EGRIDPFSRIPKKDCWQQVETFLWPPSK 316 EGRIDPFSRIPKKDCWQQVETFLWPPSK Sbjct: 61 EGRIDPFSRIPKKDCWQQVETFLWPPSK 88 >ref|XP_003609382.1| Structural maintenance of chromosomes protein [Medicago truncatula] gi|355510437|gb|AES91579.1| Structural maintenance of chromosomes protein [Medicago truncatula] Length = 661 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 398 RGGSTRSVEFRRKTVGSRWRHFFGPLQKKGNAG 300 RGGST SVEFRRKTVGS WRHFFGPL+KKGNAG Sbjct: 434 RGGSTPSVEFRRKTVGSMWRHFFGPLKKKGNAG 466 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 395 GGSTRSVEFRRKTVGSRWRHFFGPLQKKGN 306 GGSTRSVEFRRKTVGSRWRHFFGPL+KKGN Sbjct: 243 GGSTRSVEFRRKTVGSRWRHFFGPLKKKGN 272 >ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis] gi|223543139|gb|EEF44673.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = -1 Query: 400 GGEDRPVQ*NSEERLLAAGGDISLAPFKKKEMRAGLSSVEGSRIG 266 G EDRPVQ N EERLLA GGD+SLA FK+K AGLSS EGSRIG Sbjct: 67 GEEDRPVQSNFEERLLAVGGDLSLALFKRKCRGAGLSSAEGSRIG 111