BLASTX nr result
ID: Glycyrrhiza24_contig00026515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00026515 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK47782.1| unknown [Lotus japonicus] 69 3e-10 ref|XP_003630285.1| hypothetical protein MTR_8g093850 [Medicago ... 55 6e-06 >gb|AFK47782.1| unknown [Lotus japonicus] Length = 240 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 100 MVFEDFDPIFGEPKVEWATHSSCPLRPFMFHA 5 M FEDF+PIFGEPKVEWA HSSCPLRPF+FHA Sbjct: 1 MAFEDFEPIFGEPKVEWAAHSSCPLRPFLFHA 32 >ref|XP_003630285.1| hypothetical protein MTR_8g093850 [Medicago truncatula] gi|355524307|gb|AET04761.1| hypothetical protein MTR_8g093850 [Medicago truncatula] Length = 243 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 100 MVFEDFDPIFGEPKVEWATHSSCPLRPFMFHAY 2 M F+DF+PIF EPK+EW H S PLRPF+FH + Sbjct: 1 MAFQDFEPIFAEPKLEWKPHCSHPLRPFLFHVH 33