BLASTX nr result
ID: Glycyrrhiza24_contig00026409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00026409 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003600535.1| hypothetical protein LCRIS_00063 [Lactobacil... 114 6e-24 ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillu... 80 2e-13 emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG] g... 80 2e-13 ref|ZP_07758694.1| conserved domain protein [Enterococcus faecal... 54 7e-12 gb|ADI18134.1| hypothetical protein [uncultured Verrucomicrobial... 70 1e-10 >ref|YP_003600535.1| hypothetical protein LCRIS_00063 [Lactobacillus crispatus ST1] gi|295692304|ref|YP_003600914.1| hypothetical protein LCRIS_00442 [Lactobacillus crispatus ST1] gi|295692317|ref|YP_003600927.1| hypothetical protein LCRIS_00455 [Lactobacillus crispatus ST1] gi|295693512|ref|YP_003602122.1| hypothetical protein LCRIS_01650 [Lactobacillus crispatus ST1] gi|295030031|emb|CBL49510.1| conserved protein [Lactobacillus crispatus ST1] gi|295030410|emb|CBL49889.1| conserved protein [Lactobacillus crispatus ST1] gi|295030423|emb|CBL49902.1| conserved protein [Lactobacillus crispatus ST1] gi|295031618|emb|CBL51097.1| conserved protein [Lactobacillus crispatus ST1] Length = 156 Score = 114 bits (286), Expect = 6e-24 Identities = 58/71 (81%), Positives = 62/71 (87%) Frame = +2 Query: 44 VVWAVSLSTTDLITRSLTPEYKYMAFGVYLDSVTPDGPLVQTVLYLQNPNVDASPKAISE 223 ++WAVSLSTTDLITRSLTP Y Y+ F VYLDSVTPDGPLVQT LYL P +ASPKAISE Sbjct: 1 MIWAVSLSTTDLITRSLTPVYGYLEFVVYLDSVTPDGPLVQTELYLHYPLHEASPKAISE 60 Query: 224 RTSYLQVRLEF 256 RTSYLQVRLEF Sbjct: 61 RTSYLQVRLEF 71 >ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillus casei LC2W] gi|385819441|ref|YP_005855828.1| hypothetical protein LC2W_0910 [Lactobacillus casei LC2W] gi|385819457|ref|YP_005855844.1| hypothetical protein LC2W_0926 [Lactobacillus casei LC2W] gi|385820535|ref|YP_005856922.1| hypothetical protein LC2W_2006 [Lactobacillus casei LC2W] gi|385821204|ref|YP_005857591.1| hypothetical protein LC2W_2677 [Lactobacillus casei LC2W] gi|385821956|ref|YP_005858298.1| hypothetical protein LCBD_0257 [Lactobacillus casei BD-II] gi|385822604|ref|YP_005858946.1| hypothetical protein LCBD_0907 [Lactobacillus casei BD-II] gi|385822619|ref|YP_005858961.1| hypothetical protein LCBD_0922 [Lactobacillus casei BD-II] gi|385823721|ref|YP_005860063.1| hypothetical protein LCBD_2026 [Lactobacillus casei BD-II] gi|385824397|ref|YP_005860739.1| hypothetical protein LCBD_2704 [Lactobacillus casei BD-II] gi|327381108|gb|AEA52584.1| Conserved protein [Lactobacillus casei LC2W] gi|327381768|gb|AEA53244.1| Conserved protein [Lactobacillus casei LC2W] gi|327381784|gb|AEA53260.1| Conserved protein [Lactobacillus casei LC2W] gi|327382862|gb|AEA54338.1| Conserved protein [Lactobacillus casei LC2W] gi|327383531|gb|AEA55007.1| Conserved protein [Lactobacillus casei LC2W] gi|327384283|gb|AEA55757.1| Conserved protein [Lactobacillus casei BD-II] gi|327384931|gb|AEA56405.1| Conserved protein [Lactobacillus casei BD-II] gi|327384946|gb|AEA56420.1| Conserved protein [Lactobacillus casei BD-II] gi|327386048|gb|AEA57522.1| Conserved protein [Lactobacillus casei BD-II] gi|327386724|gb|AEA58198.1| Conserved protein [Lactobacillus casei BD-II] Length = 131 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +2 Query: 113 MAFGVYLDSVTPDGPLVQTVLYLQNPNVDASPKAISERTSYLQVRLEF 256 M FGVYL+SVT DGPLVQTVLYL +P+ +A+PKAISERTSYLQVRLEF Sbjct: 1 MVFGVYLNSVTLDGPLVQTVLYLHDPSSEANPKAISERTSYLQVRLEF 48 >emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257147740|emb|CAR86713.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257147759|emb|CAR86732.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257148810|emb|CAR87783.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257149424|emb|CAR88397.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257150160|emb|CAR89132.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257150679|emb|CAR89651.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257150698|emb|CAR89670.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257151737|emb|CAR90709.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257152374|emb|CAR91346.1| Conserved protein [Lactobacillus rhamnosus Lc 705] Length = 131 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +2 Query: 113 MAFGVYLDSVTPDGPLVQTVLYLQNPNVDASPKAISERTSYLQVRLEF 256 M FGVYL+SVT DGPLVQTVLYL +P+ +A+PKAISERTSYLQVRLEF Sbjct: 1 MVFGVYLNSVTLDGPLVQTVLYLHDPSSEANPKAISERTSYLQVRLEF 48 >ref|ZP_07758694.1| conserved domain protein [Enterococcus faecalis TX0470] gi|424726515|ref|ZP_18155178.1| hypothetical protein HMPREF1341_00374 [Enterococcus faecalis ERV81] gi|311293486|gb|EFQ72042.1| conserved domain protein [Enterococcus faecalis TX0470] gi|402399323|gb|EJV32201.1| hypothetical protein HMPREF1341_00374 [Enterococcus faecalis ERV81] Length = 63 Score = 53.9 bits (128), Expect(2) = 7e-12 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 173 ALFGLGARQGLLNPDKLRMPYIYIRESDCE 84 ALFGLGA GL N DKLRMP+IYIRESDCE Sbjct: 34 ALFGLGAHLGLPNSDKLRMPFIYIRESDCE 63 Score = 41.2 bits (95), Expect(2) = 7e-12 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -3 Query: 256 KFQTNLEIAGSLRNSFRASVDV 191 KFQTNLEIAGSLRNSFRAS+ + Sbjct: 6 KFQTNLEIAGSLRNSFRASLGI 27 >gb|ADI18134.1| hypothetical protein [uncultured Verrucomicrobiales bacterium HF0200_39L05] Length = 76 Score = 70.5 bits (171), Expect = 1e-10 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 1/71 (1%) Frame = -3 Query: 235 IAGSLRNSFRASVDVRILEVEHCLD*GPVRGY*IQINSECHIFIF-GSQTASDKIRSRKG 59 IAGSLRNSFRASV + + G + GY Q+NSEC + GSQ+ASDKIR R+G Sbjct: 2 IAGSLRNSFRASVGTVLRGGRALIGLGSLTGYQNQLNSECLGSHYPGSQSASDKIRRREG 61 Query: 58 NSPDHQLRSPN 26 N+PDH+LR PN Sbjct: 62 NNPDHRLRCPN 72