BLASTX nr result
ID: Glycyrrhiza24_contig00026100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00026100 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528273.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 ref|XP_003628782.1| Pentatricopeptide repeat-containing protein ... 60 2e-07 ref|XP_004149853.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 emb|CBI28135.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002281645.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_003528273.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Glycine max] Length = 805 Score = 62.0 bits (149), Expect = 5e-08 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Frame = -3 Query: 190 LTPNQFPKKLPNTAIHHSNISVLCKEGRILEAVKSLSEGC---VHVGPDIYGELLQGCVY 20 L P+ P+ L ++ S LCK GRI EAV SL++ +HVGP IYG LLQGCVY Sbjct: 4 LAPSHPPQTLTPNQFSLTHFSSLCKHGRIREAVNSLTQMHSLNLHVGPAIYGTLLQGCVY 63 Query: 19 ERALGL 2 ERAL L Sbjct: 64 ERALPL 69 >ref|XP_003628782.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522804|gb|AET03258.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1002 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -3 Query: 181 NQFPKKLPNTAIHHSNISVLCKEGRILEAVKSLSEGCVH--VGPDIYGELLQGCVYERAL 8 N FP NT +HH IS LCK ++ EA+ +LS+ H +GPDIYGELLQGCVY R L Sbjct: 63 NFFPTT--NTTLHHQ-ISFLCKNLKLQEAISTLSQLPQHTPIGPDIYGELLQGCVYARDL 119 Query: 7 GL 2 L Sbjct: 120 SL 121 >ref|XP_004149853.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Cucumis sativus] gi|449520209|ref|XP_004167126.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Cucumis sativus] Length = 840 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 3/49 (6%) Frame = -3 Query: 139 SNISVLCKEGRILEA---VKSLSEGCVHVGPDIYGELLQGCVYERALGL 2 ++IS LCK+G +LEA V L + +GPD+YGELLQGCVYERAL L Sbjct: 48 NHISSLCKQGHLLEALDLVTDLELEDITIGPDVYGELLQGCVYERALSL 96 >emb|CBI28135.3| unnamed protein product [Vitis vinifera] Length = 1974 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -3 Query: 169 KKLPNTAIHHSNISVLCKEGRILEAVKSLSE---GCVHVGPDIYGELLQGCVYERAL 8 + L + HH IS LCK+G + E+V LSE +GP+IYGELLQGCVYERAL Sbjct: 1136 RSLYKSYFHH--ISSLCKDGHLQESVHLLSEMEFEDFQIGPEIYGELLQGCVYERAL 1190 >ref|XP_002281645.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Vitis vinifera] Length = 858 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -3 Query: 169 KKLPNTAIHHSNISVLCKEGRILEAVKSLSE---GCVHVGPDIYGELLQGCVYERAL 8 + L + HH IS LCK+G + E+V LSE +GP+IYGELLQGCVYERAL Sbjct: 41 RSLYKSYFHH--ISSLCKDGHLQESVHLLSEMEFEDFQIGPEIYGELLQGCVYERAL 95