BLASTX nr result
ID: Glycyrrhiza24_contig00025989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00025989 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624654.1| Ankyrin repeat domain-containing protein [Me... 94 1e-17 ref|XP_003554031.1| PREDICTED: uncharacterized protein LOC100800... 84 2e-14 ref|XP_003548714.1| PREDICTED: uncharacterized protein LOC100814... 81 1e-13 ref|XP_002525722.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 emb|CBI39060.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_003624654.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|124359292|gb|ABD28429.2| Regulator of chromosome condensation/beta-lactamase-inhibitor protein II [Medicago truncatula] gi|355499669|gb|AES80872.1| Ankyrin repeat domain-containing protein [Medicago truncatula] Length = 1099 Score = 93.6 bits (231), Expect = 1e-17 Identities = 51/72 (70%), Positives = 54/72 (75%) Frame = -3 Query: 218 SHRRLPTPTATLPVXXXXXXXXXXXEFQRTHDKPTKMSALKLEKVQRPYSFLHPMDDPNS 39 S+RRLPTPTATLPV E QRT DKP KMSALKLEKVQR SFL P DDP+S Sbjct: 662 SYRRLPTPTATLPVIIDSEEDDYEIECQRTSDKPMKMSALKLEKVQRSDSFLQPKDDPDS 721 Query: 38 EISKVVRAIRKK 3 E+SKVVRAIRKK Sbjct: 722 EMSKVVRAIRKK 733 >ref|XP_003554031.1| PREDICTED: uncharacterized protein LOC100800604 [Glycine max] Length = 1061 Score = 83.6 bits (205), Expect = 2e-14 Identities = 47/72 (65%), Positives = 48/72 (66%) Frame = -3 Query: 218 SHRRLPTPTATLPVXXXXXXXXXXXEFQRTHDKPTKMSALKLEKVQRPYSFLHPMDDPNS 39 SHRRLPTPTAT P EFQRT DKP +KLEKV R SFLHP DDPN Sbjct: 648 SHRRLPTPTATFPAIINSEEDDSEIEFQRTCDKP-----MKLEKVHRLDSFLHPKDDPNK 702 Query: 38 EISKVVRAIRKK 3 EISKVVRAIRKK Sbjct: 703 EISKVVRAIRKK 714 >ref|XP_003548714.1| PREDICTED: uncharacterized protein LOC100814063 [Glycine max] Length = 1080 Score = 80.9 bits (198), Expect = 1e-13 Identities = 46/72 (63%), Positives = 47/72 (65%) Frame = -3 Query: 218 SHRRLPTPTATLPVXXXXXXXXXXXEFQRTHDKPTKMSALKLEKVQRPYSFLHPMDDPNS 39 SHRRLPTPTAT P EFQRT DKP +KLEKV R SFL P DDPN Sbjct: 648 SHRRLPTPTATFPAIINSEEDDSEIEFQRTRDKP-----MKLEKVLRLDSFLQPKDDPNK 702 Query: 38 EISKVVRAIRKK 3 EISKVVRAIRKK Sbjct: 703 EISKVVRAIRKK 714 >ref|XP_002525722.1| conserved hypothetical protein [Ricinus communis] gi|223535022|gb|EEF36705.1| conserved hypothetical protein [Ricinus communis] Length = 1050 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/72 (47%), Positives = 42/72 (58%) Frame = -3 Query: 218 SHRRLPTPTATLPVXXXXXXXXXXXEFQRTHDKPTKMSALKLEKVQRPYSFLHPMDDPNS 39 SHRRLPTPTAT PV + RT D K S++++ + QR FL DDP+ Sbjct: 618 SHRRLPTPTATFPVIMNSEEEDSECDIPRTRDNHEKKSSVRIAE-QRSDFFLQSEDDPSQ 676 Query: 38 EISKVVRAIRKK 3 ISK VRA+RKK Sbjct: 677 GISKRVRALRKK 688 >emb|CBI39060.3| unnamed protein product [Vitis vinifera] Length = 1025 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/72 (44%), Positives = 39/72 (54%) Frame = -3 Query: 218 SHRRLPTPTATLPVXXXXXXXXXXXEFQRTHDKPTKMSALKLEKVQRPYSFLHPMDDPNS 39 S+RRLPTPTAT P + RT D +K A + E+ QR FL P DDPN Sbjct: 595 SYRRLPTPTATFPAIIDSEEEDSKSDLLRTRDNHSKKPASREERDQRLDCFLQPKDDPNQ 654 Query: 38 EISKVVRAIRKK 3 K+VRA+ KK Sbjct: 655 GTFKLVRALWKK 666