BLASTX nr result
ID: Glycyrrhiza24_contig00025902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00025902 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552443.1| PREDICTED: probable tyrosine-protein phospha... 81 1e-13 gb|ACU24425.1| unknown [Glycine max] 81 1e-13 ref|XP_003624167.1| Tyrosine specific protein phosphatase family... 78 7e-13 ref|XP_002329001.1| predicted protein [Populus trichocarpa] gi|2... 78 7e-13 gb|ABK94324.1| unknown [Populus trichocarpa] 78 7e-13 >ref|XP_003552443.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Glycine max] Length = 200 Score = 80.9 bits (198), Expect = 1e-13 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = -2 Query: 447 TDLTFIETFDILTLRQCLYSIIYQYQGYGSRKRRLLYKDENETLQKPRLTSF 292 TDLTFIE FD+L+L QCLYSIIYQY +GS+KRRLLYKDEN LQKPRLTSF Sbjct: 153 TDLTFIEMFDVLSLSQCLYSIIYQY--HGSKKRRLLYKDEN--LQKPRLTSF 200 >gb|ACU24425.1| unknown [Glycine max] Length = 200 Score = 80.9 bits (198), Expect = 1e-13 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = -2 Query: 447 TDLTFIETFDILTLRQCLYSIIYQYQGYGSRKRRLLYKDENETLQKPRLTSF 292 TDLTFIE FD+L+L QCLYSIIYQY +GS+KRRLLYKDEN LQKPRLTSF Sbjct: 153 TDLTFIEMFDVLSLSQCLYSIIYQY--HGSKKRRLLYKDEN--LQKPRLTSF 200 >ref|XP_003624167.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi|87162589|gb|ABD28384.1| Tyrosine specific protein phosphatase and dual specificity protein phosphatase; Putative tyrosine phosphatase [Medicago truncatula] gi|355499182|gb|AES80385.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi|388496710|gb|AFK36421.1| unknown [Medicago truncatula] Length = 202 Score = 78.2 bits (191), Expect = 7e-13 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -2 Query: 444 DLTFIETFDILTLRQCLYSIIYQYQGYGSRKRRLLYKDENETLQKPRLTSF 292 DLTFIE FD+++LRQCLYSIIYQYQG S+KRRL+Y+DEN +QKPRLTSF Sbjct: 155 DLTFIERFDLVSLRQCLYSIIYQYQG-ASKKRRLMYQDEN--IQKPRLTSF 202 >ref|XP_002329001.1| predicted protein [Populus trichocarpa] gi|222839235|gb|EEE77586.1| predicted protein [Populus trichocarpa] Length = 202 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -2 Query: 447 TDLTFIETFDILTLRQCLYSIIYQYQGYGSRKRRLLYKDENETLQKPRLTS 295 TDL FIETF+++ LRQCLYSIIYQYQGYGS KRRLLY++ E++QKP++ S Sbjct: 153 TDLRFIETFEVMCLRQCLYSIIYQYQGYGSNKRRLLYQE--ESIQKPKIKS 201 >gb|ABK94324.1| unknown [Populus trichocarpa] Length = 140 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -2 Query: 447 TDLTFIETFDILTLRQCLYSIIYQYQGYGSRKRRLLYKDENETLQKPRLTS 295 TDL FIETF+++ LRQCLYSIIYQYQGYGS KRRLLY++ E++QKP++ S Sbjct: 91 TDLRFIETFEVMCLRQCLYSIIYQYQGYGSNKRRLLYQE--ESIQKPKIKS 139