BLASTX nr result
ID: Glycyrrhiza24_contig00025738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00025738 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA11845.1| metallothionein-like protein [Rubus idaeus] 68 7e-10 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 65 4e-09 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 64 1e-08 ref|XP_003527252.1| PREDICTED: uncharacterized protein LOC100305... 64 2e-08 ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|4... 64 2e-08 >emb|CAA11845.1| metallothionein-like protein [Rubus idaeus] Length = 63 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -2 Query: 252 LVIIETGKSSYDAVAEVPAGENDGKCKCGPNCACTDCKCGH 130 LVI+ET KS V + PA ENDGKCKCG C+CTDCKCGH Sbjct: 23 LVIVETEKSYDTVVMDAPAAENDGKCKCGTTCSCTDCKCGH 63 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -2 Query: 246 IIETGKSSYDAVAEVPAGENDGKCKCGPNCACTDCKCGH 130 IIET KS V + PA ENDGKCKCGP+C+CT+C CGH Sbjct: 27 IIETEKSIMTVVMDAPAAENDGKCKCGPSCSCTNCTCGH 65 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -2 Query: 246 IIETGKSSYDAVA-EVPAGENDGKCKCGPNCACTDCKCGH 130 I+ET K + V EVPAGENDGKCKCG NC+CT+C CGH Sbjct: 26 IVETEKRMVETVVMEVPAGENDGKCKCGANCSCTNCTCGH 65 >ref|XP_003527252.1| PREDICTED: uncharacterized protein LOC100305954 [Glycine max] Length = 64 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -2 Query: 249 VIIETGKSSYDAVA-EVPAGENDGKCKCGPNCACTDCKCGH 130 VI+ET KS + V +VPA E+DGKCKCG NC CTDC CGH Sbjct: 24 VIVETEKSYIETVVMDVPAAEHDGKCKCGTNCTCTDCTCGH 64 >ref|XP_002316894.1| predicted protein [Populus trichocarpa] gi|46850189|gb|AAT02526.1| metallothionein 3a [Populus trichocarpa x Populus deltoides] gi|118488217|gb|ABK95928.1| unknown [Populus trichocarpa] gi|118489949|gb|ABK96771.1| unknown [Populus trichocarpa x Populus deltoides] gi|222859959|gb|EEE97506.1| predicted protein [Populus trichocarpa] Length = 66 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -2 Query: 246 IIETGKSS-YDAVAEVPAGENDGKCKCGPNCACTDCKCGH 130 I+ET KS Y V EVPA ENDGKCKCG NC CT C CGH Sbjct: 27 IVETEKSHVYTGVMEVPATENDGKCKCGANCTCTTCTCGH 66