BLASTX nr result
ID: Glycyrrhiza24_contig00025582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00025582 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556223.1| PREDICTED: uncharacterized protein LOC100810... 74 1e-11 ref|XP_003535535.1| PREDICTED: uncharacterized protein LOC100806... 74 1e-11 ref|XP_003638559.1| Nuclear receptor corepressor [Medicago trunc... 72 4e-11 ref|XP_003591951.1| Nuclear receptor corepressor [Medicago trunc... 72 4e-11 ref|XP_002274774.2| PREDICTED: uncharacterized protein LOC100240... 63 3e-08 >ref|XP_003556223.1| PREDICTED: uncharacterized protein LOC100810588 [Glycine max] Length = 765 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +2 Query: 80 YEAKAEAQPKNATAIESHSGEAAACVTSSVPSEDTTSRKKPRLNW 214 +EAKAE PK+ ESHSGEAAAC TSSVPSEDTTSRKKPRL W Sbjct: 226 HEAKAELLPKSVAVNESHSGEAAACATSSVPSEDTTSRKKPRLGW 270 >ref|XP_003535535.1| PREDICTED: uncharacterized protein LOC100806246 [Glycine max] Length = 1372 Score = 73.9 bits (180), Expect = 1e-11 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +2 Query: 80 YEAKAEAQPKNATAIESHSGEAAACVTSSVPSEDTTSRKKPRLNW 214 +E KAE PK+ A ESHSGEAAAC TSSVPSEDTTSRKKPRL W Sbjct: 226 HEVKAELLPKSVAANESHSGEAAACATSSVPSEDTTSRKKPRLGW 270 >ref|XP_003638559.1| Nuclear receptor corepressor [Medicago truncatula] gi|355504494|gb|AES85697.1| Nuclear receptor corepressor [Medicago truncatula] Length = 1655 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 80 YEAKAEAQPKNATAIESHSGEAAACVTSSVPSEDTTSRKKPRLNW 214 YE K + KN TA+ES+SGEA ACVTSS+PSED TSRKKPRLNW Sbjct: 228 YEGKPNLKHKNVTAVESNSGEATACVTSSMPSEDATSRKKPRLNW 272 >ref|XP_003591951.1| Nuclear receptor corepressor [Medicago truncatula] gi|355480999|gb|AES62202.1| Nuclear receptor corepressor [Medicago truncatula] Length = 1682 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 80 YEAKAEAQPKNATAIESHSGEAAACVTSSVPSEDTTSRKKPRLNW 214 YE K + KN TA+ES+SGEA ACVTSS+PSED TSRKKPRLNW Sbjct: 228 YEGKPNLKHKNVTAVESNSGEATACVTSSMPSEDATSRKKPRLNW 272 >ref|XP_002274774.2| PREDICTED: uncharacterized protein LOC100240985 [Vitis vinifera] Length = 1940 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +2 Query: 83 EAKAEAQPKNATAIESHSGEAAACVTSSVPSEDTTSRKKPRLNW 214 EA+ + QP+N T ++S SG+A ACV S+ PSE+T+SRKKPRL W Sbjct: 353 EARGDLQPRNVTPVQSPSGDAVACVASTAPSEETSSRKKPRLGW 396