BLASTX nr result
ID: Glycyrrhiza24_contig00025511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00025511 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621462.1| Isoflavonoid malonyl transferase [Medicago t... 82 3e-14 gb|ABY91220.1| isoflavonoid malonyl transferase 1 [Medicago trun... 82 3e-14 ref|XP_003608200.1| Isoflavonoid malonyl transferase [Medicago t... 80 2e-13 ref|XP_003621499.1| Isoflavonoid malonyl transferase, partial [M... 80 2e-13 ref|XP_003608205.1| Isoflavonoid malonyl transferase [Medicago t... 77 2e-12 >ref|XP_003621462.1| Isoflavonoid malonyl transferase [Medicago truncatula] gi|355496477|gb|AES77680.1| Isoflavonoid malonyl transferase [Medicago truncatula] Length = 472 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -3 Query: 144 MASPNNNNIKIHEHCRVTPPPSATQTTSIPLTFFDLFWLRFHPVERVF 1 MAS NN+NIK+H+H +V PP S+T+TTSIPLTFFD+FWLRFHPVERVF Sbjct: 1 MASNNNSNIKVHDHFKVVPP-SSTKTTSIPLTFFDIFWLRFHPVERVF 47 >gb|ABY91220.1| isoflavonoid malonyl transferase 1 [Medicago truncatula] Length = 472 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -3 Query: 144 MASPNNNNIKIHEHCRVTPPPSATQTTSIPLTFFDLFWLRFHPVERVF 1 MAS NN+NIK+H+H +V PP S+T+TTSIPLTFFD+FWLRFHPVERVF Sbjct: 1 MASNNNSNIKVHDHFKVVPP-SSTKTTSIPLTFFDIFWLRFHPVERVF 47 >ref|XP_003608200.1| Isoflavonoid malonyl transferase [Medicago truncatula] gi|355509255|gb|AES90397.1| Isoflavonoid malonyl transferase [Medicago truncatula] Length = 508 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -3 Query: 144 MASPNNNNIKIHEHCRVTPPPSATQTTSIPLTFFDLFWLRFHPVERVF 1 MAS NNNN+KIHEH +V PP S+TQ T+ PLT+FD+FWLRFHPVERVF Sbjct: 1 MASNNNNNVKIHEHTKVFPP-SSTQKTTTPLTYFDIFWLRFHPVERVF 47 >ref|XP_003621499.1| Isoflavonoid malonyl transferase, partial [Medicago truncatula] gi|355496514|gb|AES77717.1| Isoflavonoid malonyl transferase, partial [Medicago truncatula] Length = 63 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -3 Query: 144 MASPNNNNIKIHEHCRVTPPPSATQTTSIPLTFFDLFWLRFHPVERVF 1 MAS NNNN+KIHEH +V PP S+TQ T+ PLT+FD+FWLRFHPVERVF Sbjct: 1 MASNNNNNVKIHEHTKVFPP-SSTQKTTTPLTYFDIFWLRFHPVERVF 47 >ref|XP_003608205.1| Isoflavonoid malonyl transferase [Medicago truncatula] gi|355509260|gb|AES90402.1| Isoflavonoid malonyl transferase [Medicago truncatula] Length = 745 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = -3 Query: 165 SSVSLSHMASPNNNNIKIHEHCRVTPPPSATQTTSIPLTFFDLFWLRFHPVERVF 1 +++ L +M S + +NIKIHEH +VTPP S+TQ T+ PLT+FD+FWLRFHPVERVF Sbjct: 375 TTLPLVYMDSIDKSNIKIHEHIKVTPP-SSTQKTTTPLTYFDIFWLRFHPVERVF 428