BLASTX nr result
ID: Glycyrrhiza24_contig00025502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00025502 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548477.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_003624580.1| Pentatricopeptide repeat-containing protein ... 75 7e-12 >ref|XP_003548477.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Glycine max] Length = 612 Score = 78.6 bits (192), Expect = 5e-13 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 6/81 (7%) Frame = +1 Query: 13 RSNLSVFPLVLLRINQQNSLAIINHCDIVQQPFMSVAFNVFNPSNTDTFLAPTKFGFSVR 192 RSNL +F +VL RI+ NS+A+ NHC IV++P M FN F+P ++TFLAP KFGFSV+ Sbjct: 5 RSNLPLFSVVLSRISH-NSIAV-NHCHIVKKPLMGATFNFFDPFKSETFLAPQKFGFSVK 62 Query: 193 LFST------LGVPTNAPALG 237 FST LG T+APA G Sbjct: 63 PFSTSSSTRSLGASTDAPAHG 83 >ref|XP_003624580.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499595|gb|AES80798.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 585 Score = 74.7 bits (182), Expect = 7e-12 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = +1 Query: 13 RSNLSVFPLVLLRINQQNSLAIINHCDIVQQPFMSVAFNVFNPSNTDTFLAPTKFGFSVR 192 RSNLSVF + LLRI +++ +NHCDIV +P M+ +FN FN SN TF AP KF FSVR Sbjct: 5 RSNLSVFSIALLRI--RHNAITVNHCDIVHKPLMNASFNAFNSSNYYTFFAPPKFSFSVR 62 Query: 193 LFS 201 FS Sbjct: 63 FFS 65