BLASTX nr result
ID: Glycyrrhiza24_contig00025462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00025462 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627915.1| Mitochondrial inner membrane protease subuni... 144 6e-33 ref|XP_003627916.1| Mitochondrial inner membrane protease subuni... 138 5e-31 ref|XP_004134638.1| PREDICTED: mitochondrial inner membrane prot... 137 1e-30 ref|XP_002283744.1| PREDICTED: mitochondrial inner membrane prot... 134 8e-30 ref|XP_004137247.1| PREDICTED: mitochondrial inner membrane prot... 132 2e-29 >ref|XP_003627915.1| Mitochondrial inner membrane protease subunit [Medicago truncatula] gi|355521937|gb|AET02391.1| Mitochondrial inner membrane protease subunit [Medicago truncatula] gi|388502086|gb|AFK39109.1| unknown [Medicago truncatula] Length = 162 Score = 144 bits (364), Expect = 6e-33 Identities = 66/101 (65%), Positives = 82/101 (81%) Frame = +2 Query: 2 MLPTIDSKPSIFLAERITIRFGQVARGDIVIVRSPENPRKVVVKRVVGMEGDTVTYLPNP 181 MLPTID PS++LAERI+ RFG+ A+GDIVI+RSP NPR + KR+VG+EGDT+TY+ +P Sbjct: 43 MLPTIDVTPSLYLAERISPRFGKAAQGDIVILRSPRNPRMCITKRLVGLEGDTITYVADP 102 Query: 182 KYSANRKTVVVPKGHVWVQGDNIYNSRDSRYFGPVPYGHIE 304 ++TVVVPKGHVW++GDN Y S DSR FGPVPYG IE Sbjct: 103 NKDDKQETVVVPKGHVWIEGDNKYKSNDSRNFGPVPYGLIE 143 >ref|XP_003627916.1| Mitochondrial inner membrane protease subunit [Medicago truncatula] gi|355521938|gb|AET02392.1| Mitochondrial inner membrane protease subunit [Medicago truncatula] Length = 201 Score = 138 bits (347), Expect = 5e-31 Identities = 66/101 (65%), Positives = 82/101 (81%) Frame = +2 Query: 2 MLPTIDSKPSIFLAERITIRFGQVARGDIVIVRSPENPRKVVVKRVVGMEGDTVTYLPNP 181 MLPTIDS PS+FLAERI+ RFG+VA GDIV +RSP+NPR+ KRV+G+EGD++TY+ + Sbjct: 43 MLPTIDSTPSMFLAERISPRFGKVAHGDIVRLRSPQNPRESYGKRVIGLEGDSITYIADR 102 Query: 182 KYSANRKTVVVPKGHVWVQGDNIYNSRDSRYFGPVPYGHIE 304 +TVVVPKGHVWV+GDN ++S DSR FGPVPYG IE Sbjct: 103 GNGYKHETVVVPKGHVWVEGDNKFSSYDSRSFGPVPYGLIE 143 >ref|XP_004134638.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 1 [Cucumis sativus] gi|449433708|ref|XP_004134639.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 2 [Cucumis sativus] gi|449505931|ref|XP_004162607.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 1 [Cucumis sativus] gi|449505935|ref|XP_004162608.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like isoform 2 [Cucumis sativus] Length = 175 Score = 137 bits (344), Expect = 1e-30 Identities = 65/101 (64%), Positives = 82/101 (81%) Frame = +2 Query: 2 MLPTIDSKPSIFLAERITIRFGQVARGDIVIVRSPENPRKVVVKRVVGMEGDTVTYLPNP 181 MLPT++ LAER++ RFG+V GDIV+VRSPENPRKVV KR++GMEGD+VTY+ +P Sbjct: 49 MLPTLNLTGDFVLAERLSTRFGRVGVGDIVLVRSPENPRKVVGKRLIGMEGDSVTYVVDP 108 Query: 182 KYSANRKTVVVPKGHVWVQGDNIYNSRDSRYFGPVPYGHIE 304 K S +TVVVPKGHVW++GDNIY+SRDSR FG VPY ++ Sbjct: 109 KNSDWSETVVVPKGHVWIEGDNIYDSRDSRNFGAVPYSLLQ 149 >ref|XP_002283744.1| PREDICTED: mitochondrial inner membrane protease subunit 1 [Vitis vinifera] gi|302142795|emb|CBI20090.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 134 bits (337), Expect = 8e-30 Identities = 61/101 (60%), Positives = 78/101 (77%) Frame = +2 Query: 2 MLPTIDSKPSIFLAERITIRFGQVARGDIVIVRSPENPRKVVVKRVVGMEGDTVTYLPNP 181 MLPT + + L E +T+R G+V GD+V+VRSPENPRK V KR++GMEGD VT++ +P Sbjct: 49 MLPTFNLTGDVLLVENLTVRMGKVRPGDVVLVRSPENPRKTVSKRILGMEGDRVTFMIDP 108 Query: 182 KYSANRKTVVVPKGHVWVQGDNIYNSRDSRYFGPVPYGHIE 304 K S ++VV+PKGHVW+QGDNIY S DSR FGPVPYG I+ Sbjct: 109 KNSNRCQSVVIPKGHVWIQGDNIYASHDSRNFGPVPYGLIQ 149 >ref|XP_004137247.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Cucumis sativus] gi|449483132|ref|XP_004156501.1| PREDICTED: mitochondrial inner membrane protease subunit 1-like [Cucumis sativus] Length = 161 Score = 132 bits (333), Expect = 2e-29 Identities = 59/101 (58%), Positives = 78/101 (77%) Frame = +2 Query: 2 MLPTIDSKPSIFLAERITIRFGQVARGDIVIVRSPENPRKVVVKRVVGMEGDTVTYLPNP 181 MLPT++ + LAE ++ R G+V GD+V+VRSP NPRK++ KR+VG+EGD V + P+P Sbjct: 43 MLPTLNLTGDVLLAEHVSHRVGRVGPGDVVLVRSPRNPRKMLTKRIVGVEGDKVNFYPDP 102 Query: 182 KYSANRKTVVVPKGHVWVQGDNIYNSRDSRYFGPVPYGHIE 304 S ++ VVPKGHVW+QGDN+Y SRDSR+FGPVPYG IE Sbjct: 103 ANSNQYQSAVVPKGHVWIQGDNVYASRDSRHFGPVPYGLIE 143