BLASTX nr result
ID: Glycyrrhiza24_contig00024951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024951 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593449.1| Cotton fiber expressed protein [Medicago tru... 55 6e-06 >ref|XP_003593449.1| Cotton fiber expressed protein [Medicago truncatula] gi|355482497|gb|AES63700.1| Cotton fiber expressed protein [Medicago truncatula] Length = 280 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = +2 Query: 11 AVSDTLPLLWSFLLHCFTPPYLYVTVNAIINSLIAFYRSDRSAAEANH 154 + + L LLW+F L CFTPPYL++TVN II S++A R S + NH Sbjct: 26 SATTNLTLLWNFFLMCFTPPYLFITVNTIIISIVASSRFHHSHTQPNH 73