BLASTX nr result
ID: Glycyrrhiza24_contig00024744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024744 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602186.1| Ethylene responsive transcription factor 1a ... 59 3e-07 >ref|XP_003602186.1| Ethylene responsive transcription factor 1a [Medicago truncatula] gi|355491234|gb|AES72437.1| Ethylene responsive transcription factor 1a [Medicago truncatula] Length = 355 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 5/55 (9%) Frame = -1 Query: 221 EKSSAAAEMKVVVDAEVE-----VSGSGYDSGDDRCLALSSPTSVLQFRSSNSEK 72 E S+ EMKVVVDA+VE + SGYDSG++ C+ LSSPTSVL FRS++ E+ Sbjct: 180 EPSTVKPEMKVVVDADVEGEASGLGNSGYDSGEEICVPLSSPTSVLNFRSNSGEE 234