BLASTX nr result
ID: Glycyrrhiza24_contig00024391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024391 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545786.1| PREDICTED: BTB/POZ domain-containing protein... 60 2e-07 ref|XP_003541765.1| PREDICTED: BTB/POZ domain-containing protein... 59 4e-07 >ref|XP_003545786.1| PREDICTED: BTB/POZ domain-containing protein At3g22104-like [Glycine max] Length = 448 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 9 LSRDLEGMEGGTQLASVKKSGIHIMSNAIYLPKLCS 116 L DLEGM+ GTQLAS+KKSG HI SNA+YLPKLCS Sbjct: 413 LRGDLEGMQSGTQLASMKKSGTHITSNAMYLPKLCS 448 >ref|XP_003541765.1| PREDICTED: BTB/POZ domain-containing protein At3g22104-like [Glycine max] Length = 546 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 9 LSRDLEGMEGGTQLASVKKSGIHIMSNAIYLPKLCS 116 L D EGM+ GTQ+AS+KKSG HIMSNA+YLPKLCS Sbjct: 511 LRGDWEGMQNGTQMASMKKSGTHIMSNAMYLPKLCS 546