BLASTX nr result
ID: Glycyrrhiza24_contig00024332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024332 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555794.1| PREDICTED: uncharacterized protein LOC100805... 98 6e-19 gb|ACJ84680.1| unknown [Medicago truncatula] 95 5e-18 ref|XP_002326739.1| predicted protein [Populus trichocarpa] gi|2... 95 7e-18 emb|CBI33853.3| unnamed protein product [Vitis vinifera] 88 6e-16 ref|XP_002277302.1| PREDICTED: cell cycle checkpoint protein RAD... 88 6e-16 >ref|XP_003555794.1| PREDICTED: uncharacterized protein LOC100805068 [Glycine max] Length = 299 Score = 98.2 bits (243), Expect = 6e-19 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = -2 Query: 261 SIGRGGMLKVQHLVSIAKPSVSHSYVDSAGYQQPGRIAHIEFFVKPEESED 109 SIGRGGMLKVQHLVSIAKPSVSH Y DS GYQQP RIAHIEFFVKPEESED Sbjct: 249 SIGRGGMLKVQHLVSIAKPSVSHPYADSVGYQQPSRIAHIEFFVKPEESED 299 >gb|ACJ84680.1| unknown [Medicago truncatula] Length = 296 Score = 95.1 bits (235), Expect = 5e-18 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -2 Query: 261 SIGRGGMLKVQHLVSIAKPSVSHSYVDSAGYQQPGRIAHIEFFVKPEESED 109 SIGRGGMLKVQHLVSI+KP+ SH YVDSAGYQQPGRIAHIEFFVKPEESED Sbjct: 247 SIGRGGMLKVQHLVSISKPT-SHPYVDSAGYQQPGRIAHIEFFVKPEESED 296 >ref|XP_002326739.1| predicted protein [Populus trichocarpa] gi|222834061|gb|EEE72538.1| predicted protein [Populus trichocarpa] Length = 303 Score = 94.7 bits (234), Expect = 7e-18 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = -2 Query: 261 SIGRGGMLKVQHLVSIAKPSVSHSYVDSAGYQQPGRIAHIEFFVKPEESED*MND 97 +IGRGGMLKVQHLVS+A+PS SH ++DSAGYQQP RIA+IEFFVKPEE ED +ND Sbjct: 249 TIGRGGMLKVQHLVSVARPSTSHQHIDSAGYQQPSRIAYIEFFVKPEEDEDTVND 303 >emb|CBI33853.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 88.2 bits (217), Expect = 6e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -2 Query: 261 SIGRGGMLKVQHLVSIAKPSVSHSYVDSAGYQQPGRIAHIEFFVKPEESED 109 +IGRGGMLKVQHLVS+A+PS+ H +VDSAGYQQP RIA+IEFFVKPEE E+ Sbjct: 244 TIGRGGMLKVQHLVSVARPSIPHPHVDSAGYQQPSRIAYIEFFVKPEEYEE 294 >ref|XP_002277302.1| PREDICTED: cell cycle checkpoint protein RAD1-like [Vitis vinifera] Length = 300 Score = 88.2 bits (217), Expect = 6e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -2 Query: 261 SIGRGGMLKVQHLVSIAKPSVSHSYVDSAGYQQPGRIAHIEFFVKPEESED 109 +IGRGGMLKVQHLVS+A+PS+ H +VDSAGYQQP RIA+IEFFVKPEE E+ Sbjct: 244 TIGRGGMLKVQHLVSVARPSIPHPHVDSAGYQQPSRIAYIEFFVKPEEYEE 294