BLASTX nr result
ID: Glycyrrhiza24_contig00024299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024299 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593513.1| hypothetical protein MTR_2g012990 [Medicago ... 189 2e-46 ref|XP_003543067.1| PREDICTED: uncharacterized protein LOC100817... 173 1e-41 ref|XP_003545875.1| PREDICTED: uncharacterized protein LOC100795... 171 4e-41 ref|XP_003635544.1| PREDICTED: uncharacterized protein LOC100854... 166 2e-39 ref|XP_002317228.1| predicted protein [Populus trichocarpa] gi|2... 159 2e-37 >ref|XP_003593513.1| hypothetical protein MTR_2g012990 [Medicago truncatula] gi|124360602|gb|ABN08601.1| CIP7 , related [Medicago truncatula] gi|355482561|gb|AES63764.1| hypothetical protein MTR_2g012990 [Medicago truncatula] Length = 890 Score = 189 bits (480), Expect = 2e-46 Identities = 92/101 (91%), Positives = 99/101 (98%) Frame = +3 Query: 6 MDSKAILDYALFQLTPTRTRFELLVFSGALREKIASGLFEPFVSHLKFVKDEISKGGYSI 185 MDSK ILDYALFQLTPTRTRFELLVF+GA+REKIASGLFEPF+SHLKFVKDEISKGGYSI Sbjct: 1 MDSKTILDYALFQLTPTRTRFELLVFNGAVREKIASGLFEPFISHLKFVKDEISKGGYSI 60 Query: 186 KLLPPTNNAFWFSKATFERFVRFVSTPAVLERFVSIEKEIQ 308 +LLPP+N AFWFSK+TFERFVRFVSTPAVLERFVS+EKEIQ Sbjct: 61 RLLPPSNTAFWFSKSTFERFVRFVSTPAVLERFVSLEKEIQ 101 >ref|XP_003543067.1| PREDICTED: uncharacterized protein LOC100817199 [Glycine max] Length = 919 Score = 173 bits (439), Expect = 1e-41 Identities = 84/101 (83%), Positives = 92/101 (91%) Frame = +3 Query: 3 DMDSKAILDYALFQLTPTRTRFELLVFSGALREKIASGLFEPFVSHLKFVKDEISKGGYS 182 D +SKAILDYALFQLTPTRTR ELLVF G + +KIASGLFEPFVSHLKF+KDEISKGGYS Sbjct: 2 DSNSKAILDYALFQLTPTRTRCELLVFCGGVHQKIASGLFEPFVSHLKFLKDEISKGGYS 61 Query: 183 IKLLPPTNNAFWFSKATFERFVRFVSTPAVLERFVSIEKEI 305 IKLLPP N AFWF++ATFERFVRFVSTPA+LERF S+E EI Sbjct: 62 IKLLPPNNGAFWFTRATFERFVRFVSTPAILERFASLENEI 102 >ref|XP_003545875.1| PREDICTED: uncharacterized protein LOC100795741 [Glycine max] Length = 935 Score = 171 bits (434), Expect = 4e-41 Identities = 83/101 (82%), Positives = 92/101 (91%) Frame = +3 Query: 3 DMDSKAILDYALFQLTPTRTRFELLVFSGALREKIASGLFEPFVSHLKFVKDEISKGGYS 182 D +SKAILDYALFQLTPTRTR ELLVF G + +KIASGLFEPFVSHLKF+KDEISKGGYS Sbjct: 2 DSNSKAILDYALFQLTPTRTRCELLVFRGGVHQKIASGLFEPFVSHLKFLKDEISKGGYS 61 Query: 183 IKLLPPTNNAFWFSKATFERFVRFVSTPAVLERFVSIEKEI 305 IKLLPP + FWF++ATFERFVRFVSTPA+LERFVS+E EI Sbjct: 62 IKLLPPNHGGFWFTRATFERFVRFVSTPAILERFVSLENEI 102 >ref|XP_003635544.1| PREDICTED: uncharacterized protein LOC100854548 [Vitis vinifera] Length = 997 Score = 166 bits (419), Expect = 2e-39 Identities = 80/100 (80%), Positives = 90/100 (90%) Frame = +3 Query: 6 MDSKAILDYALFQLTPTRTRFELLVFSGALREKIASGLFEPFVSHLKFVKDEISKGGYSI 185 MDS+ LDYALFQLTPTRTR +L++FSGA+ EK+ASGL EPF+SHLKF KD+ISKGGYSI Sbjct: 1 MDSRTHLDYALFQLTPTRTRCDLVIFSGAITEKLASGLLEPFISHLKFAKDQISKGGYSI 60 Query: 186 KLLPPTNNAFWFSKATFERFVRFVSTPAVLERFVSIEKEI 305 KLLPP +A WF+KATFERFVRFVSTP VLERFVSIEKEI Sbjct: 61 KLLPPATDASWFTKATFERFVRFVSTPEVLERFVSIEKEI 100 >ref|XP_002317228.1| predicted protein [Populus trichocarpa] gi|222860293|gb|EEE97840.1| predicted protein [Populus trichocarpa] Length = 239 Score = 159 bits (402), Expect = 2e-37 Identities = 74/100 (74%), Positives = 89/100 (89%) Frame = +3 Query: 6 MDSKAILDYALFQLTPTRTRFELLVFSGALREKIASGLFEPFVSHLKFVKDEISKGGYSI 185 M+S +LDYALFQLTPTRTR +L++F G EK+ASGLFEPF+SHL+++KD+ISKGGYSI Sbjct: 1 MNSSTLLDYALFQLTPTRTRCDLVLFYGGKNEKLASGLFEPFISHLEYIKDQISKGGYSI 60 Query: 186 KLLPPTNNAFWFSKATFERFVRFVSTPAVLERFVSIEKEI 305 KL PPT NA WF+K TFERFVRFVSTPAVLERF+S+E+EI Sbjct: 61 KLCPPTKNAPWFTKGTFERFVRFVSTPAVLERFISLEREI 100