BLASTX nr result
ID: Glycyrrhiza24_contig00024218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024218 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521979.1| PREDICTED: FACT complex subunit SSRP1-like [... 96 2e-18 ref|XP_003517023.1| PREDICTED: FACT complex subunit SSRP1-like [... 95 5e-18 sp|O04235.1|SSRP1_VICFA RecName: Full=FACT complex subunit SSRP1... 95 7e-18 ref|XP_002517473.1| structure-specific recognition protein, puta... 93 2e-17 ref|XP_004163534.1| PREDICTED: FACT complex subunit SSRP1-like, ... 93 3e-17 >ref|XP_003521979.1| PREDICTED: FACT complex subunit SSRP1-like [Glycine max] Length = 614 Score = 96.3 bits (238), Expect = 2e-18 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +3 Query: 3 KWKKMSAEEKEPYEAKARADKKRYQDEISGYQNPQPMNIDSGNESDSA 146 KWKK+SAEEKEPYEAKAR DKKRY DEISGY+NPQPMNIDSGNESDSA Sbjct: 567 KWKKLSAEEKEPYEAKAREDKKRYMDEISGYKNPQPMNIDSGNESDSA 614 >ref|XP_003517023.1| PREDICTED: FACT complex subunit SSRP1-like [Glycine max] Length = 640 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +3 Query: 3 KWKKMSAEEKEPYEAKARADKKRYQDEISGYQNPQPMNIDSGNESDSA 146 KWKK+S EEKEPYEAKAR DKKRY+DEISGY+NPQPMNIDSGNESDSA Sbjct: 593 KWKKLSVEEKEPYEAKAREDKKRYKDEISGYKNPQPMNIDSGNESDSA 640 >sp|O04235.1|SSRP1_VICFA RecName: Full=FACT complex subunit SSRP1; AltName: Full=Facilitates chromatin transcription complex subunit SSRP1; AltName: Full=Recombination signal sequence recognition protein 1 gi|2104679|emb|CAA66480.1| transcription factor [Vicia faba var. minor] Length = 642 Score = 94.7 bits (234), Expect = 7e-18 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = +3 Query: 3 KWKKMSAEEKEPYEAKARADKKRYQDEISGYQNPQPMNIDSGNESDSA 146 KWK +SAEEKEPYEAKA+ADKKRY+DEISGY+NPQPMN+DSGNESDSA Sbjct: 595 KWKNLSAEEKEPYEAKAQADKKRYKDEISGYKNPQPMNVDSGNESDSA 642 >ref|XP_002517473.1| structure-specific recognition protein, putative [Ricinus communis] gi|223543484|gb|EEF45015.1| structure-specific recognition protein, putative [Ricinus communis] Length = 640 Score = 93.2 bits (230), Expect = 2e-17 Identities = 41/47 (87%), Positives = 47/47 (100%) Frame = +3 Query: 3 KWKKMSAEEKEPYEAKARADKKRYQDEISGYQNPQPMNIDSGNESDS 143 KWKK+SAEEKEPYEAKARADKKRY++E+SGY+NPQPM+IDSGNESDS Sbjct: 593 KWKKLSAEEKEPYEAKARADKKRYKEEVSGYKNPQPMDIDSGNESDS 639 >ref|XP_004163534.1| PREDICTED: FACT complex subunit SSRP1-like, partial [Cucumis sativus] Length = 303 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +3 Query: 3 KWKKMSAEEKEPYEAKARADKKRYQDEISGYQNPQPMNIDSGNESDSA 146 KW KMSAEEKEPYE+KAR DKKRY++EISGY+NPQPMNIDSGNESDSA Sbjct: 256 KWNKMSAEEKEPYESKARDDKKRYKEEISGYKNPQPMNIDSGNESDSA 303