BLASTX nr result
ID: Glycyrrhiza24_contig00024056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024056 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical p... 104 9e-21 ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis... 104 9e-21 ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis... 102 3e-20 ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces ... 101 7e-20 ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SST... 98 6e-19 >ref|ZP_07270217.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302426770|gb|EFK98585.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 103 Score = 104 bits (259), Expect = 9e-21 Identities = 55/74 (74%), Positives = 57/74 (77%) Frame = +2 Query: 29 GTRISTGRPSTTPVGLALGPDSPRAD*LDPGTLGYSAHGFPTRHSLLMPAFSLAYPPPLD 208 GT ISTG PSTTPVGLALGPD P AD LDPGTL SAH F T SLLMPAFSL PPL Sbjct: 2 GTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSLVNRPPLA 61 Query: 209 HSAASTDTRRSPTH 250 ++AAS TRRSPTH Sbjct: 62 YAAASPGTRRSPTH 75 >ref|ZP_06577424.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291438707|ref|ZP_06578097.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291440884|ref|ZP_06580274.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291340929|gb|EFE67885.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291341602|gb|EFE68558.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291343779|gb|EFE70735.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 104 bits (259), Expect = 9e-21 Identities = 56/78 (71%), Positives = 57/78 (73%) Frame = +2 Query: 17 RCYTGTRISTGRPSTTPVGLALGPDSPRAD*LDPGTLGYSAHGFPTRHSLLMPAFSLAYP 196 RC GT ISTG PSTTPVGLALGPD P AD LDPGTL SAH F T SLLMPAFSL Sbjct: 6 RCTAGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSLVNR 65 Query: 197 PPLDHSAASTDTRRSPTH 250 P L +AAS TRRSPTH Sbjct: 66 PQLASAAASPGTRRSPTH 83 >ref|ZP_06578656.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] gi|291342161|gb|EFE69117.1| leucine rich protein [Streptomyces ghanaensis ATCC 14672] Length = 93 Score = 102 bits (255), Expect = 3e-20 Identities = 55/78 (70%), Positives = 56/78 (71%) Frame = +2 Query: 17 RCYTGTRISTGRPSTTPVGLALGPDSPRAD*LDPGTLGYSAHGFPTRHSLLMPAFSLAYP 196 RC GT ISTG PSTTPVGLALGPD P AD LDPGTL S H F T SLLMPAFSL Sbjct: 6 RCTAGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSTHTFLTCESLLMPAFSLVNR 65 Query: 197 PPLDHSAASTDTRRSPTH 250 P L +AAS TRRSPTH Sbjct: 66 PQLASAAASPGTRRSPTH 83 >ref|ZP_07287470.1| conserved hypothetical protein [Streptomyces sp. C] gi|302535772|ref|ZP_07288114.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444023|gb|EFL15839.1| conserved hypothetical protein [Streptomyces sp. C] gi|302444667|gb|EFL16483.1| conserved hypothetical protein [Streptomyces sp. C] Length = 179 Score = 101 bits (251), Expect = 7e-20 Identities = 56/79 (70%), Positives = 57/79 (72%) Frame = +2 Query: 14 GRCYTGTRISTGRPSTTPVGLALGPDSPRAD*LDPGTLGYSAHGFPTRHSLLMPAFSLAY 193 GR GT ISTG PSTTPVGLALGPD P AD LDPGTL SAH F T SLLMPAFSL Sbjct: 39 GRFKAGTGISTGCPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCVSLLMPAFSLVN 98 Query: 194 PPPLDHSAASTDTRRSPTH 250 P L +AAS TRRSPTH Sbjct: 99 RPQLASAAASPGTRRSPTH 117 >ref|ZP_06708708.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] gi|292833481|gb|EFF91830.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_02149 [Streptomyces sp. e14] Length = 106 Score = 98.2 bits (243), Expect = 6e-19 Identities = 54/78 (69%), Positives = 54/78 (69%) Frame = +2 Query: 17 RCYTGTRISTGRPSTTPVGLALGPDSPRAD*LDPGTLGYSAHGFPTRHSLLMPAFSLAYP 196 R GT ISTG PSTTPVGLALGPD P AD LDPGTL SAH F T SLLMPAFSL Sbjct: 1 RFTAGTGISTGYPSTTPVGLALGPDLPWADQLDPGTLSQSAHTFLTCESLLMPAFSLVNR 60 Query: 197 PPLDHSAASTDTRRSPTH 250 P L AAS RRSPTH Sbjct: 61 PQLPSGAASPGRRRSPTH 78