BLASTX nr result
ID: Glycyrrhiza24_contig00024047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00024047 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603913.1| Glucan endo-1,3-beta-glucosidase [Medicago t... 55 4e-06 gb|AFK44108.1| unknown [Medicago truncatula] 55 6e-06 ref|XP_003603912.1| Glucan endo-1,3-beta-glucosidase [Medicago t... 55 6e-06 ref|XP_003631648.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 55 6e-06 gb|ACJ84511.1| unknown [Medicago truncatula] 55 6e-06 >ref|XP_003603913.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] gi|355492961|gb|AES74164.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] Length = 477 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/58 (53%), Positives = 36/58 (62%) Frame = +2 Query: 131 LSFPLQLTGSHPLFHGLNLSHPLNYDHNLPPPEATAKLQKSTAIGKVRLYGADSAIIK 304 LS + F G+N + NLPPPEATAKL +ST IGKVR+YGAD AIIK Sbjct: 32 LSLTSSIFADSQSFVGVNYGQTAD---NLPPPEATAKLLQSTTIGKVRIYGADPAIIK 86 >gb|AFK44108.1| unknown [Medicago truncatula] Length = 176 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 212 NLPPPEATAKLQKSTAIGKVRLYGADSAIIK 304 NLPPPEATAKL +ST IGKVR+YGAD AIIK Sbjct: 38 NLPPPEATAKLLQSTTIGKVRIYGADPAIIK 68 >ref|XP_003603912.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] gi|355492960|gb|AES74163.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula] Length = 459 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 212 NLPPPEATAKLQKSTAIGKVRLYGADSAIIK 304 NLPPPEATAKL +ST IGKVR+YGAD AIIK Sbjct: 38 NLPPPEATAKLLQSTTIGKVRIYGADPAIIK 68 >ref|XP_003631648.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Vitis vinifera] gi|297741451|emb|CBI32582.3| unnamed protein product [Vitis vinifera] Length = 490 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +2 Query: 170 FHGLNLSHPLNYDHNLPPPEATAKLQKSTAIGKVRLYGADSAIIK 304 F G+N N NLPPPEATAKL KST+I KVRLYGAD IIK Sbjct: 58 FIGINYGQVAN---NLPPPEATAKLLKSTSIEKVRLYGADPGIIK 99 >gb|ACJ84511.1| unknown [Medicago truncatula] Length = 407 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 212 NLPPPEATAKLQKSTAIGKVRLYGADSAIIK 304 NLPPPEATAKL +ST IGKVR+YGAD AIIK Sbjct: 38 NLPPPEATAKLLQSTTIGKVRIYGADPAIIK 68