BLASTX nr result
ID: Glycyrrhiza24_contig00023975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023975 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616626.1| Cytochrome P450 [Medicago truncatula] gi|355... 209 1e-52 ref|XP_003545232.1| PREDICTED: cytochrome P450 90A1-like [Glycin... 204 8e-51 ref|XP_003519393.1| PREDICTED: cytochrome P450 90A1-like [Glycin... 202 2e-50 dbj|BAF56238.1| cytochrome P450 enzyme [Pisum sativum] 201 7e-50 ref|XP_003600878.1| Cytochrome P450 [Medicago truncatula] gi|355... 197 6e-49 >ref|XP_003616626.1| Cytochrome P450 [Medicago truncatula] gi|355517961|gb|AES99584.1| Cytochrome P450 [Medicago truncatula] Length = 492 Score = 209 bits (533), Expect = 1e-52 Identities = 106/119 (89%), Positives = 113/119 (94%) Frame = +1 Query: 37 SWSDRVFLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFTLPFPLLSTTYR 216 SWSDRV LMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFTLP PLLS+TYR Sbjct: 156 SWSDRVLLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFTLPLPLLSSTYR 215 Query: 217 RAIQARRKVAEALTLVVRERRKESATGETKNDMLGALLASGDNFSDDQIVDFMLALLVA 393 RAI+AR KVAEALTL+VR+RRKES GETK DMLGALLASGD+FS++QIVDFMLALLVA Sbjct: 216 RAIKARTKVAEALTLIVRQRRKESVMGETKTDMLGALLASGDHFSNEQIVDFMLALLVA 274 >ref|XP_003545232.1| PREDICTED: cytochrome P450 90A1-like [Glycine max] Length = 478 Score = 204 bits (518), Expect = 8e-51 Identities = 103/119 (86%), Positives = 111/119 (93%) Frame = +1 Query: 37 SWSDRVFLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFTLPFPLLSTTYR 216 SWSDR+ LMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFF++P PL S+TYR Sbjct: 160 SWSDRILLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFSVPLPLFSSTYR 219 Query: 217 RAIQARRKVAEALTLVVRERRKESATGETKNDMLGALLASGDNFSDDQIVDFMLALLVA 393 RAI+AR KVAEALTLVVRERRKES GE KNDMLGALLASG +FSD++IVDFMLALLVA Sbjct: 220 RAIKARTKVAEALTLVVRERRKESVMGEKKNDMLGALLASGYHFSDEEIVDFMLALLVA 278 >ref|XP_003519393.1| PREDICTED: cytochrome P450 90A1-like [Glycine max] Length = 479 Score = 202 bits (514), Expect = 2e-50 Identities = 103/119 (86%), Positives = 111/119 (93%) Frame = +1 Query: 37 SWSDRVFLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFTLPFPLLSTTYR 216 SWSDRV LMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFF++P PL S+TYR Sbjct: 161 SWSDRVLLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFSVPLPLFSSTYR 220 Query: 217 RAIQARRKVAEALTLVVRERRKESATGETKNDMLGALLASGDNFSDDQIVDFMLALLVA 393 RAI+AR KVAEALTLVVR+RRKES T E KNDMLGALLASG +FSD++IVDFMLALLVA Sbjct: 221 RAIKARTKVAEALTLVVRDRRKESVTEEKKNDMLGALLASGYHFSDEEIVDFMLALLVA 279 >dbj|BAF56238.1| cytochrome P450 enzyme [Pisum sativum] Length = 472 Score = 201 bits (510), Expect = 7e-50 Identities = 102/119 (85%), Positives = 110/119 (92%) Frame = +1 Query: 37 SWSDRVFLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFTLPFPLLSTTYR 216 SWSDRV LMEEAKKITFELTVKQLMSFDPGEW+E+LRKEYVLVIEGFFTLP P+LS TY Sbjct: 156 SWSDRVLLMEEAKKITFELTVKQLMSFDPGEWSESLRKEYVLVIEGFFTLPLPILSGTYS 215 Query: 217 RAIQARRKVAEALTLVVRERRKESATGETKNDMLGALLASGDNFSDDQIVDFMLALLVA 393 RAI+AR KVAEALTL+VR+RRKES E KNDMLGALLASGD+FSD+QIVDFMLALLVA Sbjct: 216 RAIKARTKVAEALTLIVRQRRKESVMVEKKNDMLGALLASGDHFSDEQIVDFMLALLVA 274 >ref|XP_003600878.1| Cytochrome P450 [Medicago truncatula] gi|355489926|gb|AES71129.1| Cytochrome P450 [Medicago truncatula] Length = 490 Score = 197 bits (502), Expect = 6e-49 Identities = 102/120 (85%), Positives = 111/120 (92%), Gaps = 1/120 (0%) Frame = +1 Query: 37 SWSDRVFLMEEAKKITFELTVKQLMSFDPGEWTETLRKEYVLVIEGFFTLPFPLLSTTYR 216 SWSDRV LMEEAKKITFELTVKQLMSFDP EWTE+LRKEY+LVIEGFFTLPFPL STTYR Sbjct: 157 SWSDRVLLMEEAKKITFELTVKQLMSFDPDEWTESLRKEYMLVIEGFFTLPFPLFSTTYR 216 Query: 217 RAIQARRKVAEALTLVVRERRKESATG-ETKNDMLGALLASGDNFSDDQIVDFMLALLVA 393 RAI+AR KVAEALTLVVR+RRKE+ G E KNDMLGALLASG+ FS+++IVDFMLALLVA Sbjct: 217 RAIKARTKVAEALTLVVRQRRKENEIGIEKKNDMLGALLASGEQFSNEEIVDFMLALLVA 276