BLASTX nr result
ID: Glycyrrhiza24_contig00023958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023958 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608458.1| hypothetical protein MTR_4g095320 [Medicago ... 62 5e-08 >ref|XP_003608458.1| hypothetical protein MTR_4g095320 [Medicago truncatula] gi|355509513|gb|AES90655.1| hypothetical protein MTR_4g095320 [Medicago truncatula] Length = 339 Score = 62.0 bits (149), Expect = 5e-08 Identities = 36/66 (54%), Positives = 40/66 (60%) Frame = +3 Query: 282 RHSHHGDKRNHVLKQFVGKGGGLLSGCDCSIETVQKPDTMVMIKGGTKSTNKAEEKSSTT 461 + + +GDK NHVLK VG GGLLSGCDCSIETV IK G K+ N TT Sbjct: 244 KKNENGDKSNHVLKNLVGIRGGLLSGCDCSIETV--------IKSGYKTEN-------TT 288 Query: 462 THAVKE 479 HAVKE Sbjct: 289 KHAVKE 294