BLASTX nr result
ID: Glycyrrhiza24_contig00023828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023828 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615335.1| E3 ubiquitin-protein ligase HUWE1 [Medicago ... 75 4e-12 ref|XP_003518270.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 73 3e-11 ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 68 9e-10 ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 65 4e-09 ref|XP_003544252.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 64 2e-08 >ref|XP_003615335.1| E3 ubiquitin-protein ligase HUWE1 [Medicago truncatula] gi|355516670|gb|AES98293.1| E3 ubiquitin-protein ligase HUWE1 [Medicago truncatula] Length = 3655 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -2 Query: 112 MTTLRSSWPSRLRQLLSSEGAIGPSIKLDSEPPPKIK 2 MTTLRS+WPSRLRQLLSSEGAIGPSIKLDSEPPPK+K Sbjct: 1 MTTLRSNWPSRLRQLLSSEGAIGPSIKLDSEPPPKVK 37 >ref|XP_003518270.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like [Glycine max] Length = 3659 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -2 Query: 112 MTTLRSSWPSRLRQLLSSEGAIGPSIKLDSEPPPKIK 2 MTTLRSSWPSRLRQLLSS GAIGPS+K+DSEPPPKIK Sbjct: 1 MTTLRSSWPSRLRQLLSSGGAIGPSVKVDSEPPPKIK 37 >ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Glycine max] Length = 3654 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 112 MTTLRSSWPSRLRQLLSSEGAIGPSIKLDSEPPPKIK 2 MT RSSWPSRLRQLLS EG+IGPS+KLDS+PPPKIK Sbjct: 1 MTNERSSWPSRLRQLLSREGSIGPSVKLDSDPPPKIK 37 >ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL2-like [Cucumis sativus] Length = 3666 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 112 MTTLRSSWPSRLRQLLSSEGAIGPSIKLDSEPPPKIK 2 MTT RSS PSRLRQLLS EG+ GPSIKLDSEPPPKIK Sbjct: 1 MTTQRSSLPSRLRQLLSGEGSFGPSIKLDSEPPPKIK 37 >ref|XP_003544252.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like [Glycine max] Length = 3673 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 112 MTTLRSSWPSRLRQLLSSEGAIGPSIKLDSEP 17 MTTLRSSWPSRLRQLLSSEGAIGPS+K+D+EP Sbjct: 1 MTTLRSSWPSRLRQLLSSEGAIGPSVKVDTEP 32