BLASTX nr result
ID: Glycyrrhiza24_contig00023819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023819 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68511.1| hypothetical protein VITISV_043839 [Vitis vinifera] 79 5e-13 ref|XP_002531176.1| nucleic acid binding protein, putative [Rici... 78 9e-13 ref|XP_003632719.1| PREDICTED: uncharacterized protein LOC100267... 77 1e-12 gb|ADL36626.1| C2H2L domain class transcription factor [Malus x ... 77 1e-12 ref|XP_002322740.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 >emb|CAN68511.1| hypothetical protein VITISV_043839 [Vitis vinifera] Length = 270 Score = 78.6 bits (192), Expect = 5e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 189 LMDKISERETHDLMNVESFSQLPFIRPAPPAMKEKGIRLFGIEFGGN 49 LMDK +ERETHD MNVESFSQLPFIRPAP +KEKGIRLFG EFGG+ Sbjct: 32 LMDKATERETHDFMNVESFSQLPFIRPAP--VKEKGIRLFGKEFGGH 76 >ref|XP_002531176.1| nucleic acid binding protein, putative [Ricinus communis] gi|223529246|gb|EEF31219.1| nucleic acid binding protein, putative [Ricinus communis] Length = 231 Score = 77.8 bits (190), Expect = 9e-13 Identities = 41/50 (82%), Positives = 43/50 (86%) Frame = -2 Query: 186 MDKISERETHDLMNVESFSQLPFIRPAPPAMKEKGIRLFGIEFGGNGAGA 37 MDK SERETHD MNVESFSQLPFIRPAP +KEK IRLFGIEFGGN + A Sbjct: 1 MDK-SERETHDFMNVESFSQLPFIRPAP--VKEKSIRLFGIEFGGNDSAA 47 >ref|XP_003632719.1| PREDICTED: uncharacterized protein LOC100267595 [Vitis vinifera] Length = 238 Score = 77.0 bits (188), Expect = 1e-12 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 186 MDKISERETHDLMNVESFSQLPFIRPAPPAMKEKGIRLFGIEFGGN 49 MDK +ERETHD MNVESFSQLPFIRPAP +KEKGIRLFG EFGG+ Sbjct: 1 MDKATERETHDFMNVESFSQLPFIRPAP--VKEKGIRLFGKEFGGH 44 >gb|ADL36626.1| C2H2L domain class transcription factor [Malus x domestica] Length = 272 Score = 77.0 bits (188), Expect = 1e-12 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -2 Query: 186 MDKISERETHDLMNVESFSQLPFIRPAPPAMKEKGIRLFGIEFGGNGA 43 MDK+ ERET D MNVESFSQLPFIRPAPP KEKGIRLFGIEFG + A Sbjct: 1 MDKV-ERETQDFMNVESFSQLPFIRPAPPLNKEKGIRLFGIEFGTDTA 47 >ref|XP_002322740.1| predicted protein [Populus trichocarpa] gi|222867370|gb|EEF04501.1| predicted protein [Populus trichocarpa] Length = 233 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -2 Query: 186 MDKISERETHDLMNVESFSQLPFIRPAPPAMKEKGIRLFGIEFGGN 49 MDK+ ERETHD MNVESFSQLPFIRPAP +KEKGIRLFGIEFG N Sbjct: 1 MDKV-ERETHDFMNVESFSQLPFIRPAP--IKEKGIRLFGIEFGSN 43