BLASTX nr result
ID: Glycyrrhiza24_contig00023793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023793 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528685.1| PREDICTED: soluble starch synthase 3, chloro... 72 4e-11 emb|CAB40374.1| Starch synthase isoform SS III [Vigna unguiculata] 66 3e-09 ref|XP_003546152.1| PREDICTED: soluble starch synthase 3, chloro... 66 3e-09 ref|XP_003541618.1| PREDICTED: soluble starch synthase 3, chloro... 66 3e-09 ref|XP_002518476.1| starch synthase, putative [Ricinus communis]... 66 3e-09 >ref|XP_003528685.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Glycine max] Length = 1084 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 3 FNTLCKTVMEQDWSWNWPALDYLELYHAARKSA 101 FNTLCKTVMEQDWSWN PALDYLELYHAARKSA Sbjct: 1052 FNTLCKTVMEQDWSWNRPALDYLELYHAARKSA 1084 >emb|CAB40374.1| Starch synthase isoform SS III [Vigna unguiculata] Length = 1147 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 3 FNTLCKTVMEQDWSWNWPALDYLELYHAARK 95 FNTLCKTVMEQDWSWN PALDYLELYHAA K Sbjct: 1115 FNTLCKTVMEQDWSWNRPALDYLELYHAACK 1145 >ref|XP_003546152.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Glycine max] Length = 1166 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 FNTLCKTVMEQDWSWNWPALDYLELYHAARKS 98 FN+LCK VMEQDWSWN PALDYLELYHAARK+ Sbjct: 1134 FNSLCKRVMEQDWSWNRPALDYLELYHAARKA 1165 >ref|XP_003541618.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Glycine max] Length = 1149 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 FNTLCKTVMEQDWSWNWPALDYLELYHAARKS 98 FN+LCK VMEQDWSWN PALDYLELYHAARK+ Sbjct: 1117 FNSLCKRVMEQDWSWNRPALDYLELYHAARKA 1148 >ref|XP_002518476.1| starch synthase, putative [Ricinus communis] gi|223542321|gb|EEF43863.1| starch synthase, putative [Ricinus communis] Length = 1058 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 FNTLCKTVMEQDWSWNWPALDYLELYHAARK 95 FN+LCKTVM+QDWSWN PALDY+ELYHAARK Sbjct: 1028 FNSLCKTVMQQDWSWNKPALDYMELYHAARK 1058