BLASTX nr result
ID: Glycyrrhiza24_contig00023754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023754 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003522542.1| PREDICTED: probable pectinesterase/pectinest... 51 7e-06 >ref|XP_003522542.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like [Glycine max] Length = 636 Score = 51.2 bits (121), Expect(3) = 7e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 231 QDTCTEGFADTSGAIKDQMPANHKDLSEMVANNL 332 QDTC EGFAD +G +KDQM N KDLSE+V+N L Sbjct: 235 QDTCAEGFADAAGTVKDQMANNLKDLSELVSNCL 268 Score = 21.2 bits (43), Expect(3) = 7e-06 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 83 RAAFDD*FELLADFINVLDFSL 148 RAA+ D ELL D ++ L SL Sbjct: 188 RAAYHDCLELLDDSVDALARSL 209 Score = 21.2 bits (43), Expect(3) = 7e-06 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 340 AGDDFSDVPI 369 AGDDF+ VPI Sbjct: 276 AGDDFAGVPI 285