BLASTX nr result
ID: Glycyrrhiza24_contig00023493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023493 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593669.1| NB-LRR type disease resistance protein Rps1-... 91 1e-16 ref|XP_003522054.1| PREDICTED: putative disease resistance prote... 89 3e-16 ref|XP_003522033.1| PREDICTED: putative disease resistance prote... 89 4e-16 ref|XP_003521995.1| PREDICTED: putative disease resistance prote... 88 6e-16 gb|AAX89382.1| NB-LRR type disease resistance protein Rps1-k-1 [... 87 2e-15 >ref|XP_003593669.1| NB-LRR type disease resistance protein Rps1-k-2 [Medicago truncatula] gi|355482717|gb|AES63920.1| NB-LRR type disease resistance protein Rps1-k-2 [Medicago truncatula] Length = 1250 Score = 90.5 bits (223), Expect = 1e-16 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +3 Query: 45 CPKLENMEGERLPTSLIKLKIYSCPLLAERCRMKHPQIWPKISHIRVINVD 197 CPKLE +EGERLP SLI+L+I CPLL ERCRMKHPQIWPKISHIR I VD Sbjct: 1196 CPKLETLEGERLPASLIELQIARCPLLEERCRMKHPQIWPKISHIRGIKVD 1246 >ref|XP_003522054.1| PREDICTED: putative disease resistance protein At3g14460-like [Glycine max] Length = 1232 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/52 (78%), Positives = 43/52 (82%) Frame = +3 Query: 42 GCPKLENMEGERLPTSLIKLKIYSCPLLAERCRMKHPQIWPKISHIRVINVD 197 GCP LENM GERLP SLIKL I+ CPLL +RCRMKHPQIWPKISHI I VD Sbjct: 1177 GCPLLENMAGERLPDSLIKLTIWECPLLEKRCRMKHPQIWPKISHIPGIKVD 1228 >ref|XP_003522033.1| PREDICTED: putative disease resistance protein At3g14460-like [Glycine max] Length = 1219 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +3 Query: 42 GCPKLENMEGERLPTSLIKLKIYSCPLLAERCRMKHPQIWPKISHIRVINVD 197 GCP LE+M GERLP SLIKL I SCPLL ++CR KHPQIWPKISHIR INVD Sbjct: 1164 GCPLLESMAGERLPVSLIKLTIESCPLLEKQCRRKHPQIWPKISHIRHINVD 1215 >ref|XP_003521995.1| PREDICTED: putative disease resistance protein At3g14460-like [Glycine max] Length = 1247 Score = 88.2 bits (217), Expect = 6e-16 Identities = 42/52 (80%), Positives = 42/52 (80%) Frame = +3 Query: 42 GCPKLENMEGERLPTSLIKLKIYSCPLLAERCRMKHPQIWPKISHIRVINVD 197 GCP LENM GERLP SLIKL I SCPLL RCRMKHPQIWPKISHI I VD Sbjct: 1192 GCPLLENMVGERLPVSLIKLTIVSCPLLEIRCRMKHPQIWPKISHIPGIQVD 1243 >gb|AAX89382.1| NB-LRR type disease resistance protein Rps1-k-1 [Glycine max] Length = 1229 Score = 86.7 bits (213), Expect = 2e-15 Identities = 41/52 (78%), Positives = 42/52 (80%) Frame = +3 Query: 42 GCPKLENMEGERLPTSLIKLKIYSCPLLAERCRMKHPQIWPKISHIRVINVD 197 GCP LENM GERLP SLIKL I SCPLL +RCR KHPQIWPKISHI I VD Sbjct: 1174 GCPLLENMVGERLPDSLIKLTIKSCPLLKKRCRKKHPQIWPKISHIPGIKVD 1225