BLASTX nr result
ID: Glycyrrhiza24_contig00023482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023482 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521255.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002521255.1| conserved hypothetical protein [Ricinus communis] gi|223539523|gb|EEF41111.1| conserved hypothetical protein [Ricinus communis] Length = 172 Score = 55.1 bits (131), Expect = 7e-06 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 206 TTSYTSLRDIMMMMPAQYP-ININASWNEIPMNIKNPLLKHAALAYLQPM 352 + +YTSL+D++ + P + NASWNEIP IKNPL+K AALAYLQPM Sbjct: 54 SATYTSLKDLLPVSPLSITSTSHNASWNEIP--IKNPLVKQAALAYLQPM 101