BLASTX nr result
ID: Glycyrrhiza24_contig00023471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023471 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530287.1| PREDICTED: uncharacterized protein LOC100779... 155 2e-36 ref|XP_003552256.1| PREDICTED: uncharacterized protein LOC100776... 152 4e-35 emb|CBI22805.3| unnamed protein product [Vitis vinifera] 120 1e-25 ref|XP_002532114.1| nucleotide binding protein, putative [Ricinu... 109 2e-22 ref|XP_002263824.1| PREDICTED: uncharacterized protein LOC100257... 106 2e-21 >ref|XP_003530287.1| PREDICTED: uncharacterized protein LOC100779801 [Glycine max] Length = 1118 Score = 155 bits (393), Expect = 2e-36 Identities = 77/81 (95%), Positives = 79/81 (97%) Frame = -1 Query: 245 MFAKRLLHKAVQHHSNYKLQHGSLQPSDLDPRIVIHYGIPSTASVLAFDPIQRLLAIGTL 66 MFAKRLLHKAVQHHSN+KLQHG LQ S+LDPRIVIHYGIPSTASVLAFDPIQRLLAIGTL Sbjct: 1 MFAKRLLHKAVQHHSNHKLQHGGLQGSELDPRIVIHYGIPSTASVLAFDPIQRLLAIGTL 60 Query: 65 DGRLKVIGGDNIEGLLVSPKQ 3 DGRLKVIGGDNIEGLLVSPKQ Sbjct: 61 DGRLKVIGGDNIEGLLVSPKQ 81 >ref|XP_003552256.1| PREDICTED: uncharacterized protein LOC100776508 [Glycine max] Length = 1115 Score = 152 bits (383), Expect = 4e-35 Identities = 75/81 (92%), Positives = 78/81 (96%) Frame = -1 Query: 245 MFAKRLLHKAVQHHSNYKLQHGSLQPSDLDPRIVIHYGIPSTASVLAFDPIQRLLAIGTL 66 MFAKRLLHKAV HHSN+KLQHG LQ ++LDPRIVIHYGIPSTASVLAFDPIQRLLAIGTL Sbjct: 1 MFAKRLLHKAVLHHSNHKLQHGGLQGNELDPRIVIHYGIPSTASVLAFDPIQRLLAIGTL 60 Query: 65 DGRLKVIGGDNIEGLLVSPKQ 3 DGRLKVIGGDNIEGLLVSPKQ Sbjct: 61 DGRLKVIGGDNIEGLLVSPKQ 81 >emb|CBI22805.3| unnamed protein product [Vitis vinifera] Length = 1127 Score = 120 bits (300), Expect = 1e-25 Identities = 62/93 (66%), Positives = 70/93 (75%), Gaps = 12/93 (12%) Frame = -1 Query: 245 MFAKRLLHKAVQHHSNYKL------------QHGSLQPSDLDPRIVIHYGIPSTASVLAF 102 MFAKRL+ KA QHH ++ QH S+ +DLD RI IHYGIPSTAS+LAF Sbjct: 1 MFAKRLIQKATQHHLHHHQHHQHQDHHQPNEQHSSVALTDLDLRIAIHYGIPSTASILAF 60 Query: 101 DPIQRLLAIGTLDGRLKVIGGDNIEGLLVSPKQ 3 DPIQRLLAIGTLDGR+KVIGGDNIEGL +SPKQ Sbjct: 61 DPIQRLLAIGTLDGRIKVIGGDNIEGLFISPKQ 93 >ref|XP_002532114.1| nucleotide binding protein, putative [Ricinus communis] gi|223528217|gb|EEF30276.1| nucleotide binding protein, putative [Ricinus communis] Length = 1096 Score = 109 bits (273), Expect = 2e-22 Identities = 54/81 (66%), Positives = 66/81 (81%), Gaps = 2/81 (2%) Frame = -1 Query: 239 AKRLLHKAVQHHSNYKL--QHGSLQPSDLDPRIVIHYGIPSTASVLAFDPIQRLLAIGTL 66 AKRL+ KAV HH + +L Q G+L+ +DLD I +HYG+PSTAS+LAFD IQRLLAI TL Sbjct: 4 AKRLIQKAVHHHHHQQLDVQRGNLKSTDLDLHISVHYGVPSTASLLAFDSIQRLLAIATL 63 Query: 65 DGRLKVIGGDNIEGLLVSPKQ 3 DGR+KVIGGD IEG+ +SPKQ Sbjct: 64 DGRIKVIGGDGIEGIFISPKQ 84 >ref|XP_002263824.1| PREDICTED: uncharacterized protein LOC100257563 [Vitis vinifera] Length = 1176 Score = 106 bits (264), Expect = 2e-21 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = -1 Query: 188 QHGSLQPSDLDPRIVIHYGIPSTASVLAFDPIQRLLAIGTLDGRLKVIGGDNIEGLLVSP 9 QH S+ +DLD RI IHYGIPSTAS+LAFDPIQRLLAIGTLDGR+KVIGGDNIEGL +SP Sbjct: 81 QHSSVALTDLDLRIAIHYGIPSTASILAFDPIQRLLAIGTLDGRIKVIGGDNIEGLFISP 140 Query: 8 KQ 3 KQ Sbjct: 141 KQ 142