BLASTX nr result
ID: Glycyrrhiza24_contig00023446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023446 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869580.1| hypothetical protein ARALYDRAFT_492089 [Arab... 91 1e-16 ref|NP_567765.2| protein PDI-like 5-4 [Arabidopsis thaliana] gi|... 91 1e-16 ref|XP_003607653.1| Endoplasmic reticulum-Golgi intermediate com... 89 3e-16 ref|XP_002522864.1| thioredoxin domain-containing protein, putat... 89 3e-16 ref|XP_002317580.1| predicted protein [Populus trichocarpa] gi|2... 89 5e-16 >ref|XP_002869580.1| hypothetical protein ARALYDRAFT_492089 [Arabidopsis lyrata subsp. lyrata] gi|297315416|gb|EFH45839.1| hypothetical protein ARALYDRAFT_492089 [Arabidopsis lyrata subsp. lyrata] Length = 480 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -2 Query: 150 MITPSKLKSVDFYRKIPRDLTEASLSGAGLSIIAALSMLFLFGMELNNY 4 M++ SK+KSVDFYRKIPRDLTEASLSGAGLSIIAALSM+FLFGMELNNY Sbjct: 1 MVSTSKIKSVDFYRKIPRDLTEASLSGAGLSIIAALSMIFLFGMELNNY 49 >ref|NP_567765.2| protein PDI-like 5-4 [Arabidopsis thaliana] gi|75213708|sp|Q9T042.1|PDI54_ARATH RecName: Full=Protein disulfide-isomerase 5-4; Short=AtPDIL5-4; AltName: Full=Protein disulfide-isomerase 7; Short=PDI7; AltName: Full=Protein disulfide-isomerase 8-2; Short=AtPDIL8-2; Flags: Precursor gi|4490704|emb|CAB38838.1| putative protein [Arabidopsis thaliana] gi|7269561|emb|CAB79563.1| putative protein [Arabidopsis thaliana] gi|15450832|gb|AAK96687.1| putative protein [Arabidopsis thaliana] gi|20259836|gb|AAM13265.1| putative protein [Arabidopsis thaliana] gi|332659897|gb|AEE85297.1| protein PDI-like 5-4 [Arabidopsis thaliana] Length = 480 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -2 Query: 150 MITPSKLKSVDFYRKIPRDLTEASLSGAGLSIIAALSMLFLFGMELNNY 4 M++ SK+KSVDFYRKIPRDLTEASLSGAGLSIIAALSM+FLFGMELNNY Sbjct: 1 MVSTSKIKSVDFYRKIPRDLTEASLSGAGLSIIAALSMIFLFGMELNNY 49 >ref|XP_003607653.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] gi|355508708|gb|AES89850.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] Length = 477 Score = 89.4 bits (220), Expect = 3e-16 Identities = 43/50 (86%), Positives = 49/50 (98%) Frame = -2 Query: 150 MITPSKLKSVDFYRKIPRDLTEASLSGAGLSIIAALSMLFLFGMELNNYF 1 M++ SKLKSVDFYRKIPRDLTEASLSGAGLSI+AAL+M+FLFGMEL+NYF Sbjct: 1 MLSASKLKSVDFYRKIPRDLTEASLSGAGLSILAALAMMFLFGMELSNYF 50 >ref|XP_002522864.1| thioredoxin domain-containing protein, putative [Ricinus communis] gi|223537948|gb|EEF39562.1| thioredoxin domain-containing protein, putative [Ricinus communis] Length = 478 Score = 89.4 bits (220), Expect = 3e-16 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 150 MITPSKLKSVDFYRKIPRDLTEASLSGAGLSIIAALSMLFLFGMELNNY 4 MI+ SKLKSVDFYRKIPRDLTEASLSGAGLSIIAALSM+FLFGMEL+NY Sbjct: 1 MISSSKLKSVDFYRKIPRDLTEASLSGAGLSIIAALSMVFLFGMELSNY 49 >ref|XP_002317580.1| predicted protein [Populus trichocarpa] gi|222860645|gb|EEE98192.1| predicted protein [Populus trichocarpa] Length = 484 Score = 88.6 bits (218), Expect = 5e-16 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = -2 Query: 150 MITPSKLKSVDFYRKIPRDLTEASLSGAGLSIIAALSMLFLFGMELNNY 4 M++ +KLKSVDFYRKIPRDLTEASLSGAGLSI+AAL+M+FLFGMELNNY Sbjct: 1 MVSTNKLKSVDFYRKIPRDLTEASLSGAGLSIVAALAMMFLFGMELNNY 49