BLASTX nr result
ID: Glycyrrhiza24_contig00023388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023388 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600705.1| Condensin complex subunit [Medicago truncatu... 64 1e-08 ref|XP_003552880.1| PREDICTED: condensin complex subunit 3-like ... 62 4e-08 ref|XP_003537443.1| PREDICTED: condensin complex subunit 3-like ... 61 8e-08 >ref|XP_003600705.1| Condensin complex subunit [Medicago truncatula] gi|355489753|gb|AES70956.1| Condensin complex subunit [Medicago truncatula] Length = 1076 Score = 63.9 bits (154), Expect = 1e-08 Identities = 38/77 (49%), Positives = 42/77 (54%) Frame = -3 Query: 450 KLELDFNLDLDGSIAMPQTPAVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTTHHHTVQ 271 KLELDFNLDLD S+AMPQTPA Q T +TV+ Sbjct: 968 KLELDFNLDLDVSVAMPQTPAAQPTRATRARRRVRIEEDSSDDEEDSQPSVVPTPVNTVK 1027 Query: 270 SRSQRASKTAAMNKMSA 220 RSQRASKTAAMNKMS+ Sbjct: 1028 GRSQRASKTAAMNKMSS 1044 >ref|XP_003552880.1| PREDICTED: condensin complex subunit 3-like [Glycine max] Length = 1096 Score = 62.4 bits (150), Expect = 4e-08 Identities = 42/83 (50%), Positives = 45/83 (54%), Gaps = 1/83 (1%) Frame = -3 Query: 450 KLELDFNLDLDGSIAMPQTPAVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTTHHHTVQ 271 KLELD +LDLDGS++MPQTPA T HTVQ Sbjct: 994 KLELDCDLDLDGSVSMPQTPAAPATRPTRSRRRVRIEEESSDEDSPSVVP---TTQHTVQ 1050 Query: 270 SRSQRASKTAAMNKM-SACRSLK 205 SRSQRASKTAAM KM SA RSLK Sbjct: 1051 SRSQRASKTAAMKKMSSATRSLK 1073 >ref|XP_003537443.1| PREDICTED: condensin complex subunit 3-like [Glycine max] Length = 1033 Score = 61.2 bits (147), Expect = 8e-08 Identities = 41/83 (49%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = -3 Query: 450 KLELDFNLDLDGSIAMPQTPAVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTTHHHTVQ 271 KLELD +LDL+GS++MPQTPA T HH+V Sbjct: 931 KLELDCDLDLNGSVSMPQTPAAPPTRPTRSRRRVRIEEESSDEDSPSAVP---TTHHSVI 987 Query: 270 SRSQRASKTAAMNKM-SACRSLK 205 SRSQRASKTAAMNKM SA RSLK Sbjct: 988 SRSQRASKTAAMNKMSSATRSLK 1010